Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Calnexin (Canx)

This Recombinant Mouse Calnexin (Canx) spans the amino acid sequence from region 21-591.

Product Specifications

Product Name Alternative

Calnexin

UniProt

P35564

Expression Region

21-591

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

HDGHDDDAIDIEDDLDDVIEEVEDSKSKSDASTPPSPKVTYKAPVPTGEVYFADSFDRGSLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTAELSLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIADPDAVKPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPFSAIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEPGVVLQMLEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQSNAMEYKKTDAPQPDVKDEEGKEEEKNKRDEEEEEEKLEEKQKSDAEEDGVTGSQDEEDSKPKAEEDEILNRSPRNRKPRRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Heptanone
TRC-H252830-5G 5 g

4-Heptanone

Sign In for Pricing
View Details
Freeze Dryer BFFT-301-A
BFFT-301-A 1 Unit

Freeze Dryer BFFT-301-A

Sign In for Pricing
View Details
MAVS Recombinant Rabbit Monoclonal Antibody [PSH0-30]
HA721310 100 µL

MAVS Recombinant Rabbit Monoclonal Antibody [PSH0-30]

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (rGFR/1667), CF740 conjugate, 0.1mg/mL
BNC743605-100 1x 100 µL

EGFR (Epidermal Growth Factor Receptor) (rGFR/1667), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Stau2 Mouse Gene Knockout Kit (CRISPR)
KN516851 1 Kit

Stau2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sparcl1 Mouse Gene Knockout Kit (CRISPR)
KN516537 1 Kit

Sparcl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details