Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Calnexin (Canx)

This Recombinant Rat Calnexin (Canx) spans the amino acid sequence from region 21-591.

Product Specifications

Product Name Alternative

Calnexin

UniProt

P35565

Expression Region

21-591

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

HDGHDDDMIDIEDDLDDVIEEVEDSKSKSDTSTPPSPKVTYKAPVPTGEVYFADSFDRGSLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTSELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIADPDAVKPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEPGVVGQMLEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQSNAMEYKKTDAPQPDVKDEEGKEEEKNKGDEEEEEEKLEEKQKSDAEEDGGTGSQDEEDSKPKAEEDEILNRSPRNRKPRRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Burkholderia mallei Probable ubiquinone biosynthesis protein UbiB (ubiB)
MBS1087703 Inquire

Recombinant Burkholderia mallei Probable ubiquinone biosynthesis protein UbiB (ubiB)

Sign In for Pricing
View Details
Bles03 (m) -PR
sc-141710-PR 10 µM - 20 µL

Bles03 (m) -PR

Sign In for Pricing
View Details
6-Benzoyl-5,7-dihydroxy-2,2-dimethylchromane
379320 5 mg

6-Benzoyl-5,7-dihydroxy-2,2-dimethylchromane

Sign In for Pricing
View Details
CD168/HMMR Rabbit Polyclonal Antibody (Cy3)
orb2607203 100 µg

CD168/HMMR Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Canine Thymic Stromal Lymphopoietin (TSLP) ELISA Kit
EIA06489Ca 1 Kit

Canine Thymic Stromal Lymphopoietin (TSLP) ELISA Kit

Sign In for Pricing
View Details
ACTB Knockout 769-P Polyclonal Cells
ARG35100 1 Million

ACTB Knockout 769-P Polyclonal Cells

Sign In for Pricing
View Details