Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Synaptotagmin-3 (Syt3)

This Recombinant Mouse Synaptotagmin-3 (Syt3) spans the amino acid sequence from region 1-587.

Product Specifications

Product Name Alternative

Synaptotagmin-3, Synaptotagmin III, SytIII

UniProt

O35681

Expression Region

1-587

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGDYEDDLCRRALILVSDLCARVRDADTNDRCQEFNELRIRGYPRGPDADISVSLLSVIVTFCGIVLLGVSLFVSWKLCWVPWRDKGGSAVGGGPLRKDLAPGVGLAGLVGGGGHHLGASLGGHPLLGGPHHHGHTAHHPPFAELLEPGGLGGSEPPEPSYLDMDSYPEAAVASVVAAGVKPSQTSPELPSEGGTGSGLLLLPPSGGGLPSAQSHQQVTSLAPTTRYPALPRPLTQQTLTTQADPSTEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRGGGSGEAGAPCGRISFALRYLYGSDHLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPIFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWRDILEGGSEKADLGELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPEAADPHGREHWAEMLANPRKPVEHWHQLVEEKTLSSFTKGGKGLSEKENSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myelin Protein Zero (MPZ) Human qPCR Template Standard (NM_000530)
HK204834 1 Kit

Myelin Protein Zero (MPZ) Human qPCR Template Standard (NM_000530)

Sign In for Pricing
View Details
4-Hydroxybenzaldehyde potassium salt
sc-290365 1 g

4-Hydroxybenzaldehyde potassium salt

Sign In for Pricing
View Details
PAR-2 (1-6) (human) 2mg
A23009-2 2 mg

PAR-2 (1-6) (human) 2mg

Sign In for Pricing
View Details
Mouse Allograft Inflammatory Factor 1 (AIF1) ELISA Kit
orb2811273-01 48 Tests

Mouse Allograft Inflammatory Factor 1 (AIF1) ELISA Kit

Sign In for Pricing
View Details
Mouse Allograft Inflammatory Factor 1 (AIF1) ELISA Kit
orb2811273-02 96 Tests

Mouse Allograft Inflammatory Factor 1 (AIF1) ELISA Kit

Sign In for Pricing
View Details
Mouse Allograft Inflammatory Factor 1 (AIF1) ELISA Kit
orb2811273-03 5 x 96 T

Mouse Allograft Inflammatory Factor 1 (AIF1) ELISA Kit

Sign In for Pricing
View Details