Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Synaptotagmin-3 (Syt3)

This Recombinant Mouse Synaptotagmin-3 (Syt3) spans the amino acid sequence from region 1-587.

Product Specifications

Product Name Alternative

Synaptotagmin-3, Synaptotagmin III, SytIII

UniProt

O35681

Expression Region

1-587

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGDYEDDLCRRALILVSDLCARVRDADTNDRCQEFNELRIRGYPRGPDADISVSLLSVIVTFCGIVLLGVSLFVSWKLCWVPWRDKGGSAVGGGPLRKDLAPGVGLAGLVGGGGHHLGASLGGHPLLGGPHHHGHTAHHPPFAELLEPGGLGGSEPPEPSYLDMDSYPEAAVASVVAAGVKPSQTSPELPSEGGTGSGLLLLPPSGGGLPSAQSHQQVTSLAPTTRYPALPRPLTQQTLTTQADPSTEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRGGGSGEAGAPCGRISFALRYLYGSDHLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPIFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWRDILEGGSEKADLGELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPEAADPHGREHWAEMLANPRKPVEHWHQLVEEKTLSSFTKGGKGLSEKENSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAPD5, NT (PAPD5, PAP-associated domain-containing protein 5, Terminal uridylyltransferase 3, Topoisomerase-related function protein 4-2) (Azide free) (HRP)
MBS6330740-01 0.2 mL

PAPD5, NT (PAPD5, PAP-associated domain-containing protein 5, Terminal uridylyltransferase 3, Topoisomerase-related function protein 4-2) (Azide free) (HRP)

Sign In for Pricing
View Details
PAPD5, NT (PAPD5, PAP-associated domain-containing protein 5, Terminal uridylyltransferase 3, Topoisomerase-related function protein 4-2) (Azide free) (HRP)
MBS6330740-02 5x 0.2 mL

PAPD5, NT (PAPD5, PAP-associated domain-containing protein 5, Terminal uridylyltransferase 3, Topoisomerase-related function protein 4-2) (Azide free) (HRP)

Sign In for Pricing
View Details
Id3 Antibody - middle region : Biotin (ARP32334_P050-Biotin)
ARP32334_P050-Biotin 100 µL

Id3 Antibody - middle region : Biotin (ARP32334_P050-Biotin)

Sign In for Pricing
View Details
RUVBL2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2079207 1.0 µg DNA

RUVBL2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
MRPL9P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV770746 1.0 µg DNA

MRPL9P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Quinacrine (hydrochloride hydrate)
C5039-500 500 mg

Quinacrine (hydrochloride hydrate)

Sign In for Pricing
View Details