Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Synaptotagmin-3 (Syt3)

This Recombinant Mouse Synaptotagmin-3 (Syt3) spans the amino acid sequence from region 1-587.

Product Specifications

Product Name Alternative

Synaptotagmin-3, Synaptotagmin III, SytIII

UniProt

O35681

Expression Region

1-587

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGDYEDDLCRRALILVSDLCARVRDADTNDRCQEFNELRIRGYPRGPDADISVSLLSVIVTFCGIVLLGVSLFVSWKLCWVPWRDKGGSAVGGGPLRKDLAPGVGLAGLVGGGGHHLGASLGGHPLLGGPHHHGHTAHHPPFAELLEPGGLGGSEPPEPSYLDMDSYPEAAVASVVAAGVKPSQTSPELPSEGGTGSGLLLLPPSGGGLPSAQSHQQVTSLAPTTRYPALPRPLTQQTLTTQADPSTEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRGGGSGEAGAPCGRISFALRYLYGSDHLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPIFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWRDILEGGSEKADLGELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPEAADPHGREHWAEMLANPRKPVEHWHQLVEEKTLSSFTKGGKGLSEKENSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COL1A2 (E-6) : m-IgGλ BP-HRP Bundle
sc-524005 1 Kit

COL1A2 (E-6) : m-IgGλ BP-HRP Bundle

Sign In for Pricing
View Details
Rabbit Anti-Human PFK-2 liv Polyclonal Antibody
PA84560HU-01 50 µg

Rabbit Anti-Human PFK-2 liv Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human PFK-2 liv Polyclonal Antibody
PA84560HU-02 100 µg

Rabbit Anti-Human PFK-2 liv Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human PFK-2 liv Polyclonal Antibody
PA84560HU-03 500 µg

Rabbit Anti-Human PFK-2 liv Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human PFK-2 liv Polyclonal Antibody
PA84560HU-04 1 mg

Rabbit Anti-Human PFK-2 liv Polyclonal Antibody

Sign In for Pricing
View Details
Ginsenoside Rg2 5mg
A14519-5 5 mg

Ginsenoside Rg2 5mg

Sign In for Pricing
View Details