Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Synaptotagmin-3 (Syt3)

This Recombinant Rat Synaptotagmin-3 (Syt3) spans the amino acid sequence from region 1-588.

Product Specifications

Product Name Alternative

Synaptotagmin-3, Synaptotagmin III, SytIII

UniProt

P40748

Expression Region

1-588

Origin

Rattus norvegicus (Rat)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGDYEDDLCRRALILVSDLCARIRDADTNDRCQEFNELRIRGYPRGPDADISVSLLSVIVTFCGIVLLGVSLFVSWKLCWVPWRDKGGSAVGGGPLRKDLAPGVGLAGLVGGGGHHLGASLGGHPLLGGPHHHAHPAHHPPFAELLEPGGLGGSEPPEPSYLDMDSYPEAAVASVVAAGVKPSQTSPELPSEGGTGSGLLLLPPSGGGLPSAQSHQQVTSLAPTTRYPALPRPLTQQTLTTQADPSSEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRTGGGSGEAGAPCGRISFALRYLYGSDQLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPIFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWRDILEGGSEKADLGELNFSLCYLPTAGLLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPEAADPHGREHWAEMLANPRKPVEHWHQLVEEKTLSSFTKGGKGLSEKENSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Urocortin 2 (UCN2)
RPU44292-01 50 µg

Recombinant Human Urocortin 2 (UCN2)

Sign In for Pricing
View Details
Recombinant Human Urocortin 2 (UCN2)
RPU44292-02 100 µg

Recombinant Human Urocortin 2 (UCN2)

Sign In for Pricing
View Details
Recombinant Human Urocortin 2 (UCN2)
RPU44292-03 1 mg

Recombinant Human Urocortin 2 (UCN2)

Sign In for Pricing
View Details
ADPGK Antibody
MBS5316378-01 0.1 mL

ADPGK Antibody

Sign In for Pricing
View Details
ADPGK Antibody
MBS5316378-02 5x 0.1 mL

ADPGK Antibody

Sign In for Pricing
View Details
DUSP19 Polyclonal Antibody
RA24353-01 50 µL

DUSP19 Polyclonal Antibody

Sign In for Pricing
View Details