Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Synaptotagmin-3 (Syt3)

This Recombinant Rat Synaptotagmin-3 (Syt3) spans the amino acid sequence from region 1-588.

Product Specifications

Product Name Alternative

Synaptotagmin-3, Synaptotagmin III, SytIII

UniProt

P40748

Expression Region

1-588

Origin

Rattus norvegicus (Rat)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGDYEDDLCRRALILVSDLCARIRDADTNDRCQEFNELRIRGYPRGPDADISVSLLSVIVTFCGIVLLGVSLFVSWKLCWVPWRDKGGSAVGGGPLRKDLAPGVGLAGLVGGGGHHLGASLGGHPLLGGPHHHAHPAHHPPFAELLEPGGLGGSEPPEPSYLDMDSYPEAAVASVVAAGVKPSQTSPELPSEGGTGSGLLLLPPSGGGLPSAQSHQQVTSLAPTTRYPALPRPLTQQTLTTQADPSSEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRTGGGSGEAGAPCGRISFALRYLYGSDQLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPIFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWRDILEGGSEKADLGELNFSLCYLPTAGLLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPEAADPHGREHWAEMLANPRKPVEHWHQLVEEKTLSSFTKGGKGLSEKENSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCherry
045847 100 µL

MCherry

Sign In for Pricing
View Details
MMP-9 (6-6B) : m-IgG1 BP-HRP Bundle
sc-531910 1 Kit

MMP-9 (6-6B) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Recombinant Saguinus oedipus Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5)
MBS1415672-01 0.02 mg (E-Coli)

Recombinant Saguinus oedipus Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5)

Sign In for Pricing
View Details
Recombinant Saguinus oedipus Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5)
MBS1415672-02 0.02 mg (Yeast)

Recombinant Saguinus oedipus Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5)

Sign In for Pricing
View Details
Recombinant Saguinus oedipus Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5)
MBS1415672-03 0.1 mg (E-Coli)

Recombinant Saguinus oedipus Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5)

Sign In for Pricing
View Details
Recombinant Saguinus oedipus Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5)
MBS1415672-04 0.1 mg (Yeast)

Recombinant Saguinus oedipus Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5)

Sign In for Pricing
View Details