Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human E-selectin (SELE)

This Recombinant Human E-selectin (SELE) spans the amino acid sequence from region 22-610.

Product Specifications

Product Name Alternative

E-selectin, CD62 antigen-like family member E, Endothelial leukocyte adhesion molecule 1, ELAM-1, Leukocyte-endothelial cell adhesion molecule 2, LECAM2, CD_antigen= CD62E

UniProt

P16581

Expression Region

22-610

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESDGSYQKPSYIL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Dog IgG (H&L) - Alexa Fluor 790
E51S4215 100 µL

Rabbit Anti-Dog IgG (H&L) - Alexa Fluor 790

Sign In for Pricing
View Details
Lentiviral human VAPA sgRNA gene knockout kit - Lentiviral human VAPA sgRNA gene knockout kit (25)
GTR15397806 1 Vial

Lentiviral human VAPA sgRNA gene knockout kit - Lentiviral human VAPA sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Recombinant Human Elongation of very long chain fatty acids protein 6 (ELOVL6), partial
MBS7100246 Inquire

Recombinant Human Elongation of very long chain fatty acids protein 6 (ELOVL6), partial

Sign In for Pricing
View Details
Alix Antibody
C12718-01 50 μL

Alix Antibody

Sign In for Pricing
View Details
Alix Antibody
C12718-02 100 µL

Alix Antibody

Sign In for Pricing
View Details
Osalmid
T0353-01 1 mL - 10 mM (in DMSO)

Osalmid

Sign In for Pricing
View Details