Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human E-selectin (SELE)

This Recombinant Human E-selectin (SELE) spans the amino acid sequence from region 22-610.

Product Specifications

Product Name Alternative

E-selectin, CD62 antigen-like family member E, Endothelial leukocyte adhesion molecule 1, ELAM-1, Leukocyte-endothelial cell adhesion molecule 2, LECAM2, CD_antigen= CD62E

UniProt

P16581

Expression Region

22-610

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESDGSYQKPSYIL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 Nucleocapsid Recombinant Protein
PO49344M2 50 µg

SARS-CoV-2 Nucleocapsid Recombinant Protein

Sign In for Pricing
View Details
Rat P50 (P50) ELISA Kit
YP-W35309-01 48 Tests

Rat P50 (P50) ELISA Kit

Sign In for Pricing
View Details
Rat P50 (P50) ELISA Kit
YP-W35309-02 96 Tests

Rat P50 (P50) ELISA Kit

Sign In for Pricing
View Details
KLK6 antibody - N-terminal region (ARP33888_P050)
ARP33888_P050 100 µL

KLK6 antibody - N-terminal region (ARP33888_P050)

Sign In for Pricing
View Details
Pannexin 1 (PANX1) Human shRNA Plasmid Kit (Locus ID 24145)
TR302694 1 Kit

Pannexin 1 (PANX1) Human shRNA Plasmid Kit (Locus ID 24145)

Sign In for Pricing
View Details
CLDN4 peptide
orb217125-01 1 mg

CLDN4 peptide

Sign In for Pricing
View Details