Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human E-selectin (SELE)

This Recombinant Human E-selectin (SELE) spans the amino acid sequence from region 22-610.

Product Specifications

Product Name Alternative

E-selectin, CD62 antigen-like family member E, Endothelial leukocyte adhesion molecule 1, ELAM-1, Leukocyte-endothelial cell adhesion molecule 2, LECAM2, CD_antigen= CD62E

UniProt

P16581

Expression Region

22-610

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESDGSYQKPSYIL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal PLA2G1B Antibody (001) [mFluor Violet 500 SE]
NBP2-90537MFV500 0.1 mL

Rabbit Monoclonal PLA2G1B Antibody (001) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
GLT25D1 (COLGALT1) Human Gene Knockout Kit (CRISPR)
KN410711 1 Kit

GLT25D1 (COLGALT1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti Duck IgY (H&L) -AbFluor 790
SA1116-01 100 µL

Anti Duck IgY (H&L) -AbFluor 790

Sign In for Pricing
View Details
Anti Duck IgY (H&L) -AbFluor 790
SA1116-02 1 mL

Anti Duck IgY (H&L) -AbFluor 790

Sign In for Pricing
View Details
Rat Receptor III For The Fc Region Of Immunoglobulin G (FcgammaRIII) ELISA Kit
MBS2611321-01 48 Well

Rat Receptor III For The Fc Region Of Immunoglobulin G (FcgammaRIII) ELISA Kit

Sign In for Pricing
View Details
Rat Receptor III For The Fc Region Of Immunoglobulin G (FcgammaRIII) ELISA Kit
MBS2611321-02 96 Well

Rat Receptor III For The Fc Region Of Immunoglobulin G (FcgammaRIII) ELISA Kit

Sign In for Pricing
View Details