Recombinant Dog E-selectin (SELE)
This Recombinant Dog E-selectin (SELE) spans the amino acid sequence from region 23-611.
Product Specifications
Product Name Alternative
E-selectin, CD62 antigen-like family member E, Endothelial leukocyte adhesion molecule 1, ELAM-1, Leukocyte-endothelial cell adhesion molecule 2, LECAM2, CD_antigen= CD62E
UniProt
P33730
Expression Region
23-611
Origin
Canis familiaris (Dog) (Canis lupus familiaris)
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
WSYNASTEAMTFDEASTYCQQRYTHLVAIQNQEEIKYLNSMFTYTPTYYWIGIRKVNKKWTWIGTQKLLTEEAKNWAPGEPNNKQNDEDCVEIYIKRDKDSGKWNDERCDKKKLALCYTAACTPTSCSGHGECVETVNNYTCKCHPGFRGLRCEQVVTCQAQEAPEHGSLVCTHPLGTFSYNSSCFVSCDKGYLPSSTEATQCTSTGEWSASPPACNVVECSALTNPCHGVMDCLQSSGNFPWNMTCTFECEEGFELMGPKRLQCTSSGNWDNRKPTCKAVTCGAIGHPQNGSVSCSHSPAGEFSVRSSCNFTCNEGFLMQGPAQIECTAQGQWSQQVPVCKASQCKALSSPERGYMSCLPGASGSFQSGSSCEFFCEKGFVLKGSKTLQCGLTGKWDSEEPTCEAVKCDAVQQPQDGLVRCAHSSTGEFTYKSSCAFSCEEGFELHGSAQLECTSQGQGVTGGPSCQVVQCFKSGSFRKDEHKLQGEPVFGAVCAFACPEGWTLNGSAALMCDATGHWSGMLPTCEAPTESSIPLAVGLTAGGTSLLTVASFLLWLLKRLRKRAKKFVPASSCQSLQSDGSYHMPCSI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog