Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog E-selectin (SELE)

This Recombinant Dog E-selectin (SELE) spans the amino acid sequence from region 23-611.

Product Specifications

Product Name Alternative

E-selectin, CD62 antigen-like family member E, Endothelial leukocyte adhesion molecule 1, ELAM-1, Leukocyte-endothelial cell adhesion molecule 2, LECAM2, CD_antigen= CD62E

UniProt

P33730

Expression Region

23-611

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

WSYNASTEAMTFDEASTYCQQRYTHLVAIQNQEEIKYLNSMFTYTPTYYWIGIRKVNKKWTWIGTQKLLTEEAKNWAPGEPNNKQNDEDCVEIYIKRDKDSGKWNDERCDKKKLALCYTAACTPTSCSGHGECVETVNNYTCKCHPGFRGLRCEQVVTCQAQEAPEHGSLVCTHPLGTFSYNSSCFVSCDKGYLPSSTEATQCTSTGEWSASPPACNVVECSALTNPCHGVMDCLQSSGNFPWNMTCTFECEEGFELMGPKRLQCTSSGNWDNRKPTCKAVTCGAIGHPQNGSVSCSHSPAGEFSVRSSCNFTCNEGFLMQGPAQIECTAQGQWSQQVPVCKASQCKALSSPERGYMSCLPGASGSFQSGSSCEFFCEKGFVLKGSKTLQCGLTGKWDSEEPTCEAVKCDAVQQPQDGLVRCAHSSTGEFTYKSSCAFSCEEGFELHGSAQLECTSQGQGVTGGPSCQVVQCFKSGSFRKDEHKLQGEPVFGAVCAFACPEGWTLNGSAALMCDATGHWSGMLPTCEAPTESSIPLAVGLTAGGTSLLTVASFLLWLLKRLRKRAKKFVPASSCQSLQSDGSYHMPCSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUPCDH, NT (CDHR5, MUCDHL, MUPCDH, Cadherin-related family member 5, Mu-protocadherin, Mucin and cadherin-like protein) (PE) discontinued
038700-PE 200 µL

MUPCDH, NT (CDHR5, MUCDHL, MUPCDH, Cadherin-related family member 5, Mu-protocadherin, Mucin and cadherin-like protein) (PE) discontinued

Sign In for Pricing
View Details
Boc-D-Allo-Ile-OH
5-05854 25 g

Boc-D-Allo-Ile-OH

Sign In for Pricing
View Details
OXLD1 (NM_001039842) Human Mass Spec Standard
PH310536 10 µg

OXLD1 (NM_001039842) Human Mass Spec Standard

Sign In for Pricing
View Details
MCSF Receptor Antibody
AF4695-01 50 µL

MCSF Receptor Antibody

Sign In for Pricing
View Details
MCSF Receptor Antibody
AF4695-02 100 µL

MCSF Receptor Antibody

Sign In for Pricing
View Details
MCSF Receptor Antibody
AF4695-03 200 µL

MCSF Receptor Antibody

Sign In for Pricing
View Details