Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calmegin (CLGN)

This Recombinant Human Calmegin (CLGN) spans the amino acid sequence from region 20-610.

Product Specifications

Product Name Alternative

Calmegin

UniProt

O14967

Expression Region

20-610

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EFMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHHAISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYIIMFGPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDERAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWRWKIMIANANKPGVLKQLMAAAEGHPWLWLIYLVTAGVPIALITSFCWPRKVKKKHKDTEYKKTDICIPQTKGVLEQEEKEEKAALEKPMDLEEEKKQNDGEMLEKEEESEPEEKSEEEIEIIEGQEESNQSNKSGSEDEMKEADESTGSGDGPIKSVRKRRVRKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MAPK12 Antibody (Monoclonal, 34M30)
M03942-1 100 µL

Anti-MAPK12 Antibody (Monoclonal, 34M30)

Sign In for Pricing
View Details
4-Octylphenol monoethoxylate-d4
HY-W741735 1 mg

4-Octylphenol monoethoxylate-d4

Sign In for Pricing
View Details
(S, R, S) -AHPC-PEG5-Azide
orb3176930-01 50 mg

(S, R, S) -AHPC-PEG5-Azide

Sign In for Pricing
View Details
(S, R, S) -AHPC-PEG5-Azide
orb3176930-02 10 mg

(S, R, S) -AHPC-PEG5-Azide

Sign In for Pricing
View Details
Mouse PDGFBB (Platelet Derived Growth Factor BB) ELISA Kit
EK248597 96 Well

Mouse PDGFBB (Platelet Derived Growth Factor BB) ELISA Kit

Sign In for Pricing
View Details
pECMV-DDOST-3 Plasmid
PVT14761 2 µg

pECMV-DDOST-3 Plasmid

Sign In for Pricing
View Details