Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calmegin (CLGN)

This Recombinant Human Calmegin (CLGN) spans the amino acid sequence from region 20-610.

Product Specifications

Product Name Alternative

Calmegin

UniProt

O14967

Expression Region

20-610

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EFMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHHAISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYIIMFGPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDERAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWRWKIMIANANKPGVLKQLMAAAEGHPWLWLIYLVTAGVPIALITSFCWPRKVKKKHKDTEYKKTDICIPQTKGVLEQEEKEEKAALEKPMDLEEEKKQNDGEMLEKEEESEPEEKSEEEIEIIEGQEESNQSNKSGSEDEMKEADESTGSGDGPIKSVRKRRVRKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 18 Polyclonal Antibody Bio Conjugated
C91474Bio 100 µL

Cytokeratin 18 Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
KBTBD3 Antibody
E92152 100 µL

KBTBD3 Antibody

Sign In for Pricing
View Details
Sstr3 (NM_009218) Mouse Tagged Lenti ORF Clone
MR225497L3 10 µg

Sstr3 (NM_009218) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Cyclophilin B discontinued
508511 100 µg

Cyclophilin B discontinued

Sign In for Pricing
View Details
Tifcemalimab Biosimilar (Monoclonal, IgG4)
A138585 100 µL

Tifcemalimab Biosimilar (Monoclonal, IgG4)

Sign In for Pricing
View Details
Boc-Gly-Val-Val-CHO
BML-PI128-0005 5 mg

Boc-Gly-Val-Val-CHO

Sign In for Pricing
View Details