Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Peptidyl-prolyl cis-trans isomerase D (ppiD)

This Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Peptidyl-prolyl cis-trans isomerase D (ppiD) spans the amino acid sequence from region 1-623.

Product Specifications

Product Name Alternative

Peptidyl-prolyl cis-trans isomerase D, PPIase D, EC= 5.2.1.8, Rotamase D

UniProt

P57550

Expression Region

1-623

Origin

Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKYSQARLNSIIVKFILGVIILSLILSTISIYINRDFEKYIATVNGEKISFNLFKKMYFIEREKQKKILGKNFFKFSHNENFTKETYNYVLSQLINNVLLEQYAKNMNYLEVNDNTIKKIIYNSPIFQKNNKFSKERYLNYLTSINSTNHEYINIIKKKINTENLIHTISKSNFILKKEEKNIIKLLSQKRIIKKAIVKIDPSIYKKNITNQEAQIYFKKNQDNFYIPEKFKINFVELKTDNFKIHCENKEIYDWYIRNITQYSTKEKRRYSIIQVKNKQQAISILSRLHNTPEDFSKIAQEQSTDPISSKKDGDIGWISIDLIPDEIKHANLNKKNQISDVIPFHNEFLIVKLNETQIGTQKKIYEVFDSIKKQIKQKKSLDLYNELKNKISNNLKNDPGKIERILKENNILIQETDWFDKKSIPKVLNIPILKQFIFNKKLFQKDTTVKPQFHFIVLKKNQSFLIKIKKFKNKEIQHFENVKKNIIKKLRFIKAIKETKKKSEEIIYDLTQGRKKLFKQSNLYFTDPEIISRYDLSAITSIVFSLPHPQKGKKIYTLYNDKNKNFIIISLEKVYNTNFSEKEKNVILEYLSRHNTEIIFNSILKDLREKSIIKYENIVNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL
BNC402216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF405S conjugate, 0.1mg/mL
BNC040449-100 1x 100 µL

CD104 (UM-A9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF568 conjugate, 0.1mg/mL
BNC680333-500 1x 500 µL

CD8 (RIV11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL
BNC401050-500 1x 500 µL

CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL
BNC681081-500 1x 500 µL

CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2946R), CF405S conjugate, 0.1mg/mL
BNC042946-100 1x 100 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2946R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details