Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Growth hormone receptor (Ghr)

This Recombinant Mouse Growth hormone receptor (Ghr) spans the amino acid sequence from region 25-650.

Product Specifications

Product Name Alternative

Growth hormone receptor, GH receptor, Somatotropin receptor, Cleaved into the following chain:, 1. Growth hormone-binding protein, 2. GH-binding protein, 3. GHBP, Serum-binding protein

UniProt

P16882

Expression Region

25-650

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TPATLGKASPVLQRINPSLGTSSSGKPRFTKCRSPELETFSCYWTEGDNPDLKTPGSIQLYYAKRESQRQAARIAHEWTQEWKECPDYVSAGKNSCYFNSSYTSIWIPYCIKLTTNGDLLDQKCFTVDEIVQPDPPIGLNWTLLNISLTGIRGDIQVSWQPPPNADVLKGWIILEYEIQYKEVNESKWKVMGPIWLTYCPVYSLRMDKEHEVRVRSRQRSFEKYSEFSEVLRVIFPQTNILEACEEDIQFPWFLIIIFGIFGVAVMLFVVIFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILGIHDNYKPDFYNDDSWVEFIELDIDEADVDEKTEGSDTDRLLSNDHEKSAGILGAKDDDSGRTSCYDPDILDTDFHTSDMCDGTLKFRQSQKLNMEADLLCLDQKNLKNLPYDASLGSLHPSITQTVEENKPQPLLSSETEATHQLASTPMSNPTSLANIDFYAQVSDITPAGGDVLSPGQKIKAGIAQGNTQREVATPCQENYSMNSAYFCESDAKKCIAVARRMEATSCIKPSFNQEDIYITTESLTTTAQMSETADIAPDAEMSVPDYTTVHTVQSPRGLILNATALPLPDKKNFPSSCGYVSTDQLNKIMQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Smad1 qPCR Primer Pair
QM03842S 200 Tests

Mouse Smad1 qPCR Primer Pair

Sign In for Pricing
View Details
Gab3 (NM_181584) Mouse Tagged ORF Clone
MR217167 10 µg

Gab3 (NM_181584) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal USP28 Antibody
NBP1-82904 0.1 mL

Rabbit Polyclonal USP28 Antibody

Sign In for Pricing
View Details
Evc (BC021464) Mouse Tagged Lenti ORF Clone
MR209571L4 10 µg

Evc (BC021464) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Antithrombin III (Antithrombin-III, ATIII, PRO0309, AT3, Serpin C1, SERPINC1) (FITC) discontinued
A2298-26B-FITC 100 µL

Antithrombin III (Antithrombin-III, ATIII, PRO0309, AT3, Serpin C1, SERPINC1) (FITC) discontinued

Sign In for Pricing
View Details
Anti-HIP1R Antibody Picoband®, FITC Conjugate
A05059-2-FITC 100 µg/Vial

Anti-HIP1R Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details