Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Growth hormone receptor (Ghr)

This Recombinant Mouse Growth hormone receptor (Ghr) spans the amino acid sequence from region 25-650.

Product Specifications

Product Name Alternative

Growth hormone receptor, GH receptor, Somatotropin receptor, Cleaved into the following chain:, 1. Growth hormone-binding protein, 2. GH-binding protein, 3. GHBP, Serum-binding protein

UniProt

P16882

Expression Region

25-650

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TPATLGKASPVLQRINPSLGTSSSGKPRFTKCRSPELETFSCYWTEGDNPDLKTPGSIQLYYAKRESQRQAARIAHEWTQEWKECPDYVSAGKNSCYFNSSYTSIWIPYCIKLTTNGDLLDQKCFTVDEIVQPDPPIGLNWTLLNISLTGIRGDIQVSWQPPPNADVLKGWIILEYEIQYKEVNESKWKVMGPIWLTYCPVYSLRMDKEHEVRVRSRQRSFEKYSEFSEVLRVIFPQTNILEACEEDIQFPWFLIIIFGIFGVAVMLFVVIFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILGIHDNYKPDFYNDDSWVEFIELDIDEADVDEKTEGSDTDRLLSNDHEKSAGILGAKDDDSGRTSCYDPDILDTDFHTSDMCDGTLKFRQSQKLNMEADLLCLDQKNLKNLPYDASLGSLHPSITQTVEENKPQPLLSSETEATHQLASTPMSNPTSLANIDFYAQVSDITPAGGDVLSPGQKIKAGIAQGNTQREVATPCQENYSMNSAYFCESDAKKCIAVARRMEATSCIKPSFNQEDIYITTESLTTTAQMSETADIAPDAEMSVPDYTTVHTVQSPRGLILNATALPLPDKKNFPSSCGYVSTDQLNKIMQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASGR1 Antibody
MBS9401043-01 0.1 mL

ASGR1 Antibody

Sign In for Pricing
View Details
ASGR1 Antibody
MBS9401043-02 5x 0.1 mL

ASGR1 Antibody

Sign In for Pricing
View Details
Alkaline serine protease ver112 Antibody
orb863226 2 mg

Alkaline serine protease ver112 Antibody

Sign In for Pricing
View Details
Nudifloric Acid
S3313-25mg 25 mg

Nudifloric Acid

Sign In for Pricing
View Details
CORO2B Rabbit pAb
E45R23267N-100 100 µL

CORO2B Rabbit pAb

Sign In for Pricing
View Details
Escherichia coli, J5 LPS (E. coli) (APC)
E3500-28J-APC 100 µL

Escherichia coli, J5 LPS (E. coli) (APC)

Sign In for Pricing
View Details