Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Amiloride-sensitive sodium channel subunit beta (SCNN1B)

This Recombinant Sheep Amiloride-sensitive sodium channel subunit beta (SCNN1B) spans the amino acid sequence from region 1-632.

Product Specifications

Product Name Alternative

Amiloride-sensitive sodium channel subunit beta, Beta-NaCH, Epithelial Na (+) channel subunit beta, Beta-ENaC, Nonvoltage-gated sodium channel 1 subunit beta, SCNEB

UniProt

O62816

Expression Region

1-632

Origin

Ovis aries (Sheep)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHLKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFVLTLLFT SLVCWQWGLFIKTYLNWEVSVSLSIGFKTMDFPAVTICNASPFQYSKVQHLLKDLDALME AVLGRILGPELSQVNATTALNLSIWHHTPLVFINEQNPHHPVVLDLFEDNFNGSASSSPA PGRPCSARRCKVAMRLCSHNGTTCTFRNFSSATQAVTEWYTLQATNIFAQVPNQELVAMG YPAERLILACLFGAEPCNYRNFTPIFHPDYGNCYIFNWGMTEKALPSANPGTEFGLKLIL DMGQEDYVPFLTSTAGARLMLHEQRSYPFIKEEGIYAMAGMETSIGVLVDKLQRKGEPYS QCTKNGSDVPIQNLYSSYNTTYSIQACIRSCFQEHMIRECGCGHYLYPLPDKRKYCNNQE FPDWAHCYSALRISMAQRETCIYACKESCKLLGTSPPLPPCLLPPVSPQDWIFHVLSQER DQSSNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIE FGEIIIDFVWITIIKLVALAKSVRGPPPTVAELVEAHTNFGFQPDSAMPGPDAGAYRREQ NPPIPGTPPPNYDSLRLQPLDVIESDSEGDAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIM-1 (T Cell Immunoglobin Domain and Mucin Domain Protein 1, TIM 1, TIM1, TIMD 1, TIMD1, TIMD-1, Hepatitis A Virus Cellular Receptor 1, HAVCR 1, HAVCR1, HAVCR-1, Kidney Injury Molecule 1, KIM1, KIM-1) (FITC)
MBS6150112-01 0.1 mL

TIM-1 (T Cell Immunoglobin Domain and Mucin Domain Protein 1, TIM 1, TIM1, TIMD 1, TIMD1, TIMD-1, Hepatitis A Virus Cellular Receptor 1, HAVCR 1, HAVCR1, HAVCR-1, Kidney Injury Molecule 1, KIM1, KIM-1) (FITC)

Sign In for Pricing
View Details
TIM-1 (T Cell Immunoglobin Domain and Mucin Domain Protein 1, TIM 1, TIM1, TIMD 1, TIMD1, TIMD-1, Hepatitis A Virus Cellular Receptor 1, HAVCR 1, HAVCR1, HAVCR-1, Kidney Injury Molecule 1, KIM1, KIM-1) (FITC)
MBS6150112-02 5x 0.1 mL

TIM-1 (T Cell Immunoglobin Domain and Mucin Domain Protein 1, TIM 1, TIM1, TIMD 1, TIMD1, TIMD-1, Hepatitis A Virus Cellular Receptor 1, HAVCR 1, HAVCR1, HAVCR-1, Kidney Injury Molecule 1, KIM1, KIM-1) (FITC)

Sign In for Pricing
View Details
Human NEBL siRNA
abx925673-01 15 nmol

Human NEBL siRNA

Sign In for Pricing
View Details
Human NEBL siRNA
abx925673-02 30 nmol

Human NEBL siRNA

Sign In for Pricing
View Details
6-Bromo-3- (4’-bromophenyl) -4-phenylcoumarin
OR351218 1 Each

6-Bromo-3- (4’-bromophenyl) -4-phenylcoumarin

Sign In for Pricing
View Details
pIA Plasmid
PVT5202 2 µg

pIA Plasmid

Sign In for Pricing
View Details