Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-cynomolgus.html

Purity

98.00

Smiles

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-579-3p agomir
HY-R01804A-01 5 nmol

Hsa-miR-579-3p agomir

Sign In for Pricing
View Details
Hsa-miR-579-3p agomir
HY-R01804A-02 20 nmol

Hsa-miR-579-3p agomir

Sign In for Pricing
View Details
RIN1 (Ras and Rab Interactor 1, Ras Interaction/Interference Protein 1, Ras Inhibitor JC99) (HRP)
132583-HRP 100 µL

RIN1 (Ras and Rab Interactor 1, Ras Interaction/Interference Protein 1, Ras Inhibitor JC99) (HRP)

Sign In for Pricing
View Details
Human NLRC4 shRNA Plasmid
abx961713-01 150 µg

Human NLRC4 shRNA Plasmid

Sign In for Pricing
View Details
Human NLRC4 shRNA Plasmid
abx961713-02 300 µg

Human NLRC4 shRNA Plasmid

Sign In for Pricing
View Details
Human Nuclear receptor-interacting protein 1 (NRIP1) ELISA Kit
YP-W18186-01 48 Tests

Human Nuclear receptor-interacting protein 1 (NRIP1) ELISA Kit

Sign In for Pricing
View Details