Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-cynomolgus.html

Purity

98.00

Smiles

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MHC Class II RT1B Antibody (OX-6) [DyLight 405]
NB100-65541V 0.25 mL

Mouse Monoclonal MHC Class II RT1B Antibody (OX-6) [DyLight 405]

Sign In for Pricing
View Details
Mouse Tceanc2 Pre-designed siRNA Set A
SI114365A 1 Each

Mouse Tceanc2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Complete Supplement Mixture w/o URA
G112-100G 1 unit

Complete Supplement Mixture w/o URA

Sign In for Pricing
View Details
SLC19A1 (NM_194255) Human Tagged ORF Clone Lentiviral Particle
RC222669L3V 200 µL

SLC19A1 (NM_194255) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Iso5-2DC18
MF-0159268-01 5 mg

Iso5-2DC18

Sign In for Pricing
View Details
Iso5-2DC18
MF-0159268-02 50 mg

Iso5-2DC18

Sign In for Pricing
View Details