Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-cynomolgus.html

Purity

98.00

Smiles

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

P38 MAPK (Ab-182) discontinued
327185 100 µL

P38 MAPK (Ab-182) discontinued

Sign In for Pricing
View Details
GMPS Protein Vector (Mouse) (pPM-C-His)
PV185177 500 ng

GMPS Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Shewanella sp. Na (+)-translocating NADH-quinone reductase subunit D (nqrD), partial
MBS7072941 Inquire

Recombinant Shewanella sp. Na (+)-translocating NADH-quinone reductase subunit D (nqrD), partial

Sign In for Pricing
View Details
Voclosporin
BA8083-5.1 1 mL (10 mM in DMSO)

Voclosporin

Sign In for Pricing
View Details
Dectin 1 (CLEC7A) Rabbit Polyclonal Antibody
TA356828 100 µL

Dectin 1 (CLEC7A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HORMAD2 Protein Vector (Mouse) (pPM-C-HA)
PV189528 500 ng

HORMAD2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details