Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-cynomolgus.html

Purity

98.00

Smiles

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIF1 (Allograft Inflammatory Factor 1, AIF-1, DASS-82G15.2, G1, IBA1, IRT-1, Em:AF129756.17, Interferon gamma Responsive Transcript, IRT-1, Ionized Calcium-binding Adapter Molecule, Protein G1) (MaxLight 405) discontinued
A1059-86-ML405 100 µL

AIF1 (Allograft Inflammatory Factor 1, AIF-1, DASS-82G15.2, G1, IBA1, IRT-1, Em:AF129756.17, Interferon gamma Responsive Transcript, IRT-1, Ionized Calcium-binding Adapter Molecule, Protein G1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Xpress™ Human FGF14 Over-expressing Stable Cell Line
ABC-X1128 1 Vial

Xpress™ Human FGF14 Over-expressing Stable Cell Line

Sign In for Pricing
View Details
MIR4695 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV769952 1.0 µg DNA

MIR4695 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Gphn Mouse siRNA Oligo Duplex (Locus ID 268566)
SR419993 1 Kit

Gphn Mouse siRNA Oligo Duplex (Locus ID 268566)

Sign In for Pricing
View Details
EVPLL Protein Vector (Human) (pPM-C-HA)
PV076291 500 ng

EVPLL Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Phosphodiesterase 1C (Calmodulin Dependent (PDE1C) Mouse ELISA Kit
F8481 96 Tests

Phosphodiesterase 1C (Calmodulin Dependent (PDE1C) Mouse ELISA Kit

Sign In for Pricing
View Details