Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-cynomolgus.html

Purity

98.00

Smiles

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABRA6 Protein Vector (Mouse) (pPM-C-HA)
PV180932 500 ng

GABRA6 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O17:K52:H18 (strain UMN026/ExPEC) mhpF Polyclonal Antibody
MBS7178043 Inquire

Rabbit anti-Escherichia coli O17:K52:H18 (strain UMN026/ExPEC) mhpF Polyclonal Antibody

Sign In for Pricing
View Details
Boc-Ile-OH
MF-0154219 500 mg

Boc-Ile-OH

Sign In for Pricing
View Details
Anti-Proteasome 20S alpha 3 Polyclonal Antibody
MF-0087638-01 50 µL

Anti-Proteasome 20S alpha 3 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Proteasome 20S alpha 3 Polyclonal Antibody
MF-0087638-02 100 µL

Anti-Proteasome 20S alpha 3 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Proteasome 20S alpha 3 Polyclonal Antibody
MF-0087638-03 200 µL

Anti-Proteasome 20S alpha 3 Polyclonal Antibody

Sign In for Pricing
View Details