Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-cynomolgus.html

Purity

98.00

Smiles

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFPI mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
TA805675 100 µL

TFPI mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)

Sign In for Pricing
View Details
Tert-butyl 3,3-bis (hydroxymethyl) azetidine-1-carboxylate
JH30679 1 Each

Tert-butyl 3,3-bis (hydroxymethyl) azetidine-1-carboxylate

Sign In for Pricing
View Details
CSPG6 (Structural Maintenance of Chromosomes 3, BAM, BMH, CDLS3, CSPG6, HCAP, SMC3L1) (APC)
MBS6169135-01 0.1 mL

CSPG6 (Structural Maintenance of Chromosomes 3, BAM, BMH, CDLS3, CSPG6, HCAP, SMC3L1) (APC)

Sign In for Pricing
View Details
CSPG6 (Structural Maintenance of Chromosomes 3, BAM, BMH, CDLS3, CSPG6, HCAP, SMC3L1) (APC)
MBS6169135-02 5x 0.1 mL

CSPG6 (Structural Maintenance of Chromosomes 3, BAM, BMH, CDLS3, CSPG6, HCAP, SMC3L1) (APC)

Sign In for Pricing
View Details
L-Asparagine monohydrate for biochemistry
5562KG001 1 Kg

L-Asparagine monohydrate for biochemistry

Sign In for Pricing
View Details
Porcine Immunoglobulin G3, IgG3 ELISA Kit
MBS1600887-01 48 Well

Porcine Immunoglobulin G3, IgG3 ELISA Kit

Sign In for Pricing
View Details