Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-cynomolgus.html

Purity

98.00

Smiles

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

JNK2 (MAPK9) (NM_002752) Human Over-expression Lysate
LC400972 20 µg

JNK2 (MAPK9) (NM_002752) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SPAPB1A10.16 Polyclonal Antibody
MBS7151504 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SPAPB1A10.16 Polyclonal Antibody

Sign In for Pricing
View Details
PE/Cyanine7 anti-human CD48
GT11306 25 Tests

PE/Cyanine7 anti-human CD48

Sign In for Pricing
View Details
Glyctk (NM_174846) Mouse Tagged Lenti ORF Clone
MR208380L3 10 µg

Glyctk (NM_174846) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Swt1 Pre-designed siRNA Set B
SI114106B 1 Each

Mouse Swt1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
ARSA (Arylsulfatase A, ASA, Cerebroside-sulfatase, Arylsulfatase A Component B, Arylsulfatase A Component C) (Biotin)
123575-Biotin 100 µL

ARSA (Arylsulfatase A, ASA, Cerebroside-sulfatase, Arylsulfatase A Component B, Arylsulfatase A Component C) (Biotin)

Sign In for Pricing
View Details