Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-cynomolgus.html

Purity

98.00

Smiles

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Liraglutide (LRT) Polyclonal Antibody
CAU32824-01 100 µL

Liraglutide (LRT) Polyclonal Antibody

Sign In for Pricing
View Details
Liraglutide (LRT) Polyclonal Antibody
CAU32824-02 200 µL

Liraglutide (LRT) Polyclonal Antibody

Sign In for Pricing
View Details
Liraglutide (LRT) Polyclonal Antibody
CAU32824-03 1 mL

Liraglutide (LRT) Polyclonal Antibody

Sign In for Pricing
View Details
ASAH2 Rabbit Polyclonal Antibody
E53P12605 100 µL

ASAH2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TTLL5 Rabbit Polyclonal Antibody
TA360373 100 µL

TTLL5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WFDC2 Protein Vector (Mouse) (pPB-C-His)
PV247334 500 ng

WFDC2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details