Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-cynomolgus.html

Purity

98.00

Smiles

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

rno-miR-6326 miRNA Antagomir
MNR01739 2x 5.0 nmol

rno-miR-6326 miRNA Antagomir

Sign In for Pricing
View Details
GPR149 (NM_001038705) Human Tagged Lenti ORF Clone
RC223772L1 10 µg

GPR149 (NM_001038705) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat St2a1 ELISA Kit
ELI-46239r 96 Tests

Rat St2a1 ELISA Kit

Sign In for Pricing
View Details
LRRC8A shRNA Plasmid (m)
sc-149105-SH 20 µg

LRRC8A shRNA Plasmid (m)

Sign In for Pricing
View Details
ANAPC7, CT (Anaphase-promoting Complex Subunit 7, APC7, Cyclosome Subunit 7)
MBS644997-01 0.05 mg

ANAPC7, CT (Anaphase-promoting Complex Subunit 7, APC7, Cyclosome Subunit 7)

Sign In for Pricing
View Details
ANAPC7, CT (Anaphase-promoting Complex Subunit 7, APC7, Cyclosome Subunit 7)
MBS644997-02 5x 0.05 mg

ANAPC7, CT (Anaphase-promoting Complex Subunit 7, APC7, Cyclosome Subunit 7)

Sign In for Pricing
View Details