Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-cynomolgus.html

Purity

98.00

Smiles

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf226 Knockout HGC-27 Polyclonal Cells
ARG41304 1 Million

C1orf226 Knockout HGC-27 Polyclonal Cells

Sign In for Pricing
View Details
Elongin C (EloC, Transcription Elongation Factor B Polypeptide 1) (MaxLight 750) discontinued
214807-ML750 100 µL

Elongin C (EloC, Transcription Elongation Factor B Polypeptide 1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
SPATA7 Antibody
DF12749-01 100 µL

SPATA7 Antibody

Sign In for Pricing
View Details
SPATA7 Antibody
DF12749-02 200 µL

SPATA7 Antibody

Sign In for Pricing
View Details
RCBTB2 Antibody; Biotin conjugated
MBS7006568-01 0.05 mg

RCBTB2 Antibody; Biotin conjugated

Sign In for Pricing
View Details
RCBTB2 Antibody; Biotin conjugated
MBS7006568-02 0.1 mg

RCBTB2 Antibody; Biotin conjugated

Sign In for Pricing
View Details