Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-cynomolgus.html

Purity

98.00

Smiles

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BICC1 Knockout A549 Polyclonal Cells
ARG31936 1 Million

BICC1 Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details
APE1 Antibody
GWB-979FBA 0.1 mg

APE1 Antibody

Sign In for Pricing
View Details
Add1 Rat shRNA Plasmid (Locus ID 24170)
TR709810 1 Kit

Add1 Rat shRNA Plasmid (Locus ID 24170)

Sign In for Pricing
View Details
SPACA4 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV648569 1.0 µg DNA

SPACA4 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Azetidine-2-carboxamide
sc-284972A 1 g

Azetidine-2-carboxamide

Sign In for Pricing
View Details
Recombinant Human MOS Protein, N-His
YHB87001 100 μg

Recombinant Human MOS Protein, N-His

Sign In for Pricing
View Details