Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-cynomolgus.html

Purity

98.00

Smiles

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pLV3-CMV-AMH-3×FLAG-CopGFP-Puro Plasmid
PVT50898 2 µg

pLV3-CMV-AMH-3×FLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Human basic fibroblast growth factor 9,bFGF-9 ELISA Kit
CN-03199H1 96T

Human basic fibroblast growth factor 9,bFGF-9 ELISA Kit

Sign In for Pricing
View Details
Anti-Epidiymis Protein 4 (HE4) Antibody
34085 200ug

Anti-Epidiymis Protein 4 (HE4) Antibody

Sign In for Pricing
View Details
Lentiviral human KIAA1522 sgRNA gene knockout kit - Lentiviral human KIAA1522 sgRNA gene knockout kit (25)
GTR15386790 1 Vial

Lentiviral human KIAA1522 sgRNA gene knockout kit - Lentiviral human KIAA1522 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
KCNIP3 3'UTR Luciferase Stable Cell Line
TU011496 1.0 mL

KCNIP3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
IP3KB Polyclonal Antibody
MBS2554047-01 0.025 mL

IP3KB Polyclonal Antibody

Sign In for Pricing
View Details