Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-cynomolgus.html

Purity

98.00

Smiles

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse AP1M2 shRNA Plasmid
abx969161-01 150 µg

Mouse AP1M2 shRNA Plasmid

Sign In for Pricing
View Details
Mouse AP1M2 shRNA Plasmid
abx969161-02 300 µg

Mouse AP1M2 shRNA Plasmid

Sign In for Pricing
View Details
ZNF425 (NM_001001661) Human Over-expression Lysate
LS155054-20ug 20 µg

ZNF425 (NM_001001661) Human Over-expression Lysate

Sign In for Pricing
View Details
GPR26 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F3]
TA811685BM 100 µL

GPR26 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F3]

Sign In for Pricing
View Details
Recombinant Human LINGO-2 Protein - (Dry Ice)
H00158038-P01-2ug 2 µg

Recombinant Human LINGO-2 Protein - (Dry Ice)

Sign In for Pricing
View Details
ADAMTS4 Protein Vector (Human) (pPM-C-HA)
PV000719 500 ng

ADAMTS4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details