Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-cynomolgus.html

Purity

98.00

Smiles

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Procollagen Ⅲ C-terminal Peptide (PⅢCP) Elisa Kit
EK713269 96 Well

Human Procollagen Ⅲ C-terminal Peptide (PⅢCP) Elisa Kit

Sign In for Pricing
View Details
Rabbit Polyclonal transgelin 2 Antibody [Alexa Fluor 405]
NBP2-36550AF405 0.1 mL

Rabbit Polyclonal transgelin 2 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Signal Transducing Adaptor Molecule (STAM) Antibody
abx115561 100 µL

Signal Transducing Adaptor Molecule (STAM) Antibody

Sign In for Pricing
View Details
CA150 (TCERG1) Human Gene Knockout Kit (CRISPR)
KN217192BN 1 Kit

CA150 (TCERG1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TMEM161B Lentiviral Activation Particles (h)
sc-414731-LAC 200 µL

TMEM161B Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Strumpellin (WASHC5) Human siRNA Oligo Duplex (Locus ID 9897)
SR306641 1 Kit

Strumpellin (WASHC5) Human siRNA Oligo Duplex (Locus ID 9897)

Sign In for Pricing
View Details