Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-cynomolgus.html

Purity

98.00

Smiles

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VSV-G (Vesicular Stomatitis Virus Glycoprotein) (Cy3)
V5000-01C 100 µg

VSV-G (Vesicular Stomatitis Virus Glycoprotein) (Cy3)

Sign In for Pricing
View Details
RASL11B (NM_023940) Human Over-expression Lysate
LY402964 100 µg

RASL11B (NM_023940) Human Over-expression Lysate

Sign In for Pricing
View Details
ALG11 (BC010857) Human Untagged Clone
SC123675 10 µg

ALG11 (BC010857) Human Untagged Clone

Sign In for Pricing
View Details
Anti-DAK Rabbit pAb
GB113139-100 100 μL

Anti-DAK Rabbit pAb

Sign In for Pricing
View Details
Rabbit Monoclonal Human Coronavirus Spike Protein Antibody (028) [Alexa Fluor 750]
NBP2-90334AF750 0.1 mL

Rabbit Monoclonal Human Coronavirus Spike Protein Antibody (028) [Alexa Fluor 750]

Sign In for Pricing
View Details
UBE2L3 discontinued
515512 100 µg

UBE2L3 discontinued

Sign In for Pricing
View Details