Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-cynomolgus.html

Purity

98.00

Smiles

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAPPC2P7 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV787623 1.0 µg DNA

TRAPPC2P7 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Rabbit Polyclonal SMPDL3A Antibody [mFluor Violet 610 SE]
NBP3-20170MFV610 0.1 mL

Rabbit Polyclonal SMPDL3A Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
IL13 (Interleukin 13, ALRH, BHR1, IL-13, MGC116786, MGC116788, MGC116789, P600) (MaxLight 405) discontinued
247522-ML405 100 µL

IL13 (Interleukin 13, ALRH, BHR1, IL-13, MGC116786, MGC116788, MGC116789, P600) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Tex16 Protein Vector (Mouse) (pPM-C-HA)
PV237680 500 ng

Tex16 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
CHRM2 Antibody
R35375-100UG 100 µg

CHRM2 Antibody

Sign In for Pricing
View Details
Faah sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3758103 1.0 µg DNA

Faah sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details