Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-cynomolgus.html

Purity

98.00

Smiles

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

JNJ-5207852 100mg
A21480-100 100 mg

JNJ-5207852 100mg

Sign In for Pricing
View Details
GBGT1 (NM_001288572) Human Untagged Clone
SC335196 10 µg

GBGT1 (NM_001288572) Human Untagged Clone

Sign In for Pricing
View Details
Dpp6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6914407 1.0 µg DNA

Dpp6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Mouse TIM-3 Affinity Purified Polyclonal Ab
AF1529-SP 25 µg

Mouse TIM-3 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
LOXL4 (Lysyl Oxidase Homolog 4, Lysyl Oxidase-like Protein 4, Lysyl Oxidase-related Protein C, LOXC) (HRP)
MBS6153348-01 0.1 mL

LOXL4 (Lysyl Oxidase Homolog 4, Lysyl Oxidase-like Protein 4, Lysyl Oxidase-related Protein C, LOXC) (HRP)

Sign In for Pricing
View Details
LOXL4 (Lysyl Oxidase Homolog 4, Lysyl Oxidase-like Protein 4, Lysyl Oxidase-related Protein C, LOXC) (HRP)
MBS6153348-02 5x 0.1 mL

LOXL4 (Lysyl Oxidase Homolog 4, Lysyl Oxidase-like Protein 4, Lysyl Oxidase-related Protein C, LOXC) (HRP)

Sign In for Pricing
View Details