Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-cynomolgus.html

Purity

98.00

Smiles

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ranbp10 3'UTR Lenti-reporter-Luc Vector
38474086 1.0 µg

Ranbp10 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
GENLISA™ Human Inosine triphosphate pyrophosphatase (ITPA) ELISA
KBH2026 1x 96 Well

GENLISA™ Human Inosine triphosphate pyrophosphatase (ITPA) ELISA

Sign In for Pricing
View Details
Rat Fam161b Pre-designed siRNA Set B
SI204758B 1 Each

Rat Fam161b Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lentiviral mouse H2bc14 shRNA (UAS) - Lentiviral mouse H2bc14 shRNA (UAS) (100)
GTR15186414 1 Vial

Lentiviral mouse H2bc14 shRNA (UAS) - Lentiviral mouse H2bc14 shRNA (UAS) (100)

Sign In for Pricing
View Details
Mouse Monoclonal USF2 Antibody (PCRP-USF2-1A7) [Alexa Fluor 647]
NBP3-24186AF647 0.1 mL

Mouse Monoclonal USF2 Antibody (PCRP-USF2-1A7) [Alexa Fluor 647]

Sign In for Pricing
View Details
CABC1 Rabbit Polyclonal Antibody
E53P02368 100 µL

CABC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details