Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-cynomolgus.html

Purity

98.00

Smiles

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal NCOA2 Antibody (OTI3C7) [DyLight 488]
NBP2-72894G 0.1 mL

Mouse Monoclonal NCOA2 Antibody (OTI3C7) [DyLight 488]

Sign In for Pricing
View Details
Cystine Heart Agar
30620002-2 1 Kg

Cystine Heart Agar

Sign In for Pricing
View Details
Abca17 Mouse siRNA Oligo Duplex (Locus ID 381072)
SR423167 1 Kit

Abca17 Mouse siRNA Oligo Duplex (Locus ID 381072)

Sign In for Pricing
View Details
TRAFD1 (NM_001143906) Human 3' UTR Clone
SC210260 10 µg

TRAFD1 (NM_001143906) Human 3' UTR Clone

Sign In for Pricing
View Details
CD70 Protein (C-Fc, Mus musculus (Mouse) )
P502224 100 µg

CD70 Protein (C-Fc, Mus musculus (Mouse) )

Sign In for Pricing
View Details
Phencyclidine (Phenylcyclohexylpiperidine, PCP) (MaxLight 550) discontinued
P3380-11E-ML550 100 µL

Phencyclidine (Phenylcyclohexylpiperidine, PCP) (MaxLight 550) discontinued

Sign In for Pricing
View Details