Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-cynomolgus.html

Purity

98.00

Smiles

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1052 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV626954 1.0 µg DNA

Olr1052 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Mouse Neuroglobin,NGB ELISA Kit
CN-02616M2 48T

Mouse Neuroglobin,NGB ELISA Kit

Sign In for Pricing
View Details
IGJ, NT (Immunoglobulin J Chain, IGCJ, Immunoglobulin J Polypeptide Linker Protein for Immunoglobulin alpha and mu Polypeptides, JCH)
I1904-95 200 µL

IGJ, NT (Immunoglobulin J Chain, IGCJ, Immunoglobulin J Polypeptide Linker Protein for Immunoglobulin alpha and mu Polypeptides, JCH)

Sign In for Pricing
View Details
Zfp691 (NM_001145936) Mouse Tagged ORF Clone
MR217231 10 µg

Zfp691 (NM_001145936) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human C6orf25 knockdown cell line
ABC-KD2120 1 Vial

Human C6orf25 knockdown cell line

Sign In for Pricing
View Details
Human OR2AP1 siRNA
abx927085-01 15 nmol

Human OR2AP1 siRNA

Sign In for Pricing
View Details