Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-cynomolgus.html

Purity

98.00

Smiles

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Drosophila yakuba NADH-ubiquinone oxidoreductase chain 4 (mt:ND4), partial
MBS1129395-01 1 mg (E-Coli)

Recombinant Drosophila yakuba NADH-ubiquinone oxidoreductase chain 4 (mt:ND4), partial

Sign In for Pricing
View Details
Recombinant Drosophila yakuba NADH-ubiquinone oxidoreductase chain 4 (mt:ND4), partial
MBS1129395-02 1 mg (Yeast)

Recombinant Drosophila yakuba NADH-ubiquinone oxidoreductase chain 4 (mt:ND4), partial

Sign In for Pricing
View Details
Mouse Monoclonal E2F-4 Antibody (E2F4/4224) [Alexa Fluor 647]
NBP3-26925AF647 0.1 mL

Mouse Monoclonal E2F-4 Antibody (E2F4/4224) [Alexa Fluor 647]

Sign In for Pricing
View Details
Rabbit Polyclonal CHD3 Antibody [Alexa Fluor 405]
NB100-60412AF405 0.1 mL

Rabbit Polyclonal CHD3 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Recombinant Mycobacterium Gilvum rpsH Protein (aa 1-132)
VAng-Yyj4005-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Gilvum rpsH Protein (aa 1-132)

Sign In for Pricing
View Details
Human GAGE12F activation kit by CRISPRa
GA119061 1 Kit

Human GAGE12F activation kit by CRISPRa

Sign In for Pricing
View Details