Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 beta, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

14-3-3 beta Protein, Cynomolgus, Cynomolgus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-beta-protein-cynomolgus.html

Purity

98.00

Smiles

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Molecular Formula

101926442 (Gene_ID) Q4R572-2 (M1-N244) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMGDH Polyclonal Antibody
RA24238-01 50 µL

DMGDH Polyclonal Antibody

Sign In for Pricing
View Details
DMGDH Polyclonal Antibody
RA24238-02 100 µL

DMGDH Polyclonal Antibody

Sign In for Pricing
View Details
POLR1C Protein Vector (Rat) (pPB-C-His)
PV295118 500 ng

POLR1C Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
CRBN ligand-771
HY-W999697 1 Each

CRBN ligand-771

Sign In for Pricing
View Details
Mouse ALT1/GPT1 Recombinant Protein
PROTQ8QZR5-100ug 100 µg

Mouse ALT1/GPT1 Recombinant Protein

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O1:K1/APEC PURT Polyclonal Antibody
MBS7166954 Inquire

Rabbit anti-Escherichia coli O1:K1/APEC PURT Polyclonal Antibody

Sign In for Pricing
View Details