Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Integrin beta-2 (ITGB2)

This Recombinant Pig Integrin beta-2 (ITGB2) spans the amino acid sequence from region 23-769.

Product Specifications

Product Name Alternative

Integrin beta-2, Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta, Complement receptor C3 subunit beta, CD_antigen= CD18

UniProt

P53714

Expression Region

23-769

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QECAKYKVSTCRDCIESGPGCAWCQKLNFSGQGEPDSVRCDTREQLLAKGCVADDIVDPRSLAETQEDQAGGQKQLSPQKVTLYLRPGQAATFNVTFRRAKGYPIDLYYLMDLSYSMLDDLINVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPEKLRNPCPNKEKECQAPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKSSNEFDYPSVGQLAHKLAESNIQPIFAVTKKMVKTYEKLTDIIPKSAVGELSEDSSNVLELIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVSQVNQPRGDCDGVQINVPITFQVKVTASECIQEQSFVIRALGFTDTVTVRVLPQCECRCGDSSKERTLCGNKGSMECGVCRCDAGYIGKHCECQTQGRSSQELEGSCRKDNSSIICSGLGDCICGQCVCHTSDVPNKKIYGQFCECDNMNCERFDGQVCGGEKRGLCFCSTCRCQEGFEGSACQCLKSTQGCLNLQGVECSGRGRCRCNVCQCDFGYQPPLCTDCPSCQVPCARYAKCAECLKFDTGPFAKNCSAECGTTKLLPSRMSGRKCNERDSEGCWMTYFLVQRDGRDNYDLHVEETRECVKGPNIAAIVGGTVGGVVLVGIFLLVIWKVLTHLSDLREYKRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAER

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syntaxin 1A + Syntaxin 1B Rabbit Polyclonal Antibody (BF555)
orb2459766 100 µL

Syntaxin 1A + Syntaxin 1B Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
NDUFAF4, NT (NDUFAF4, C6orf66, HRPAP20, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4, Hormone-regulated proliferation-associated protein of 20kD) (Biotin) discontinued
038863-Biotin 200 µL

NDUFAF4, NT (NDUFAF4, C6orf66, HRPAP20, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4, Hormone-regulated proliferation-associated protein of 20kD) (Biotin) discontinued

Sign In for Pricing
View Details
Serum Albumin (ALB) Antibody (HRP)
abx107865-01 20 µg

Serum Albumin (ALB) Antibody (HRP)

Sign In for Pricing
View Details
Serum Albumin (ALB) Antibody (HRP)
abx107865-02 50 µg

Serum Albumin (ALB) Antibody (HRP)

Sign In for Pricing
View Details
Serum Albumin (ALB) Antibody (HRP)
abx107865-03 100 µg

Serum Albumin (ALB) Antibody (HRP)

Sign In for Pricing
View Details
Serum Albumin (ALB) Antibody (HRP)
abx107865-04 200 µg

Serum Albumin (ALB) Antibody (HRP)

Sign In for Pricing
View Details