Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Integrin beta-2 (ITGB2)

This Recombinant Pig Integrin beta-2 (ITGB2) spans the amino acid sequence from region 23-769.

Product Specifications

Product Name Alternative

Integrin beta-2, Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta, Complement receptor C3 subunit beta, CD_antigen= CD18

UniProt

P53714

Expression Region

23-769

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QECAKYKVSTCRDCIESGPGCAWCQKLNFSGQGEPDSVRCDTREQLLAKGCVADDIVDPRSLAETQEDQAGGQKQLSPQKVTLYLRPGQAATFNVTFRRAKGYPIDLYYLMDLSYSMLDDLINVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPEKLRNPCPNKEKECQAPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKSSNEFDYPSVGQLAHKLAESNIQPIFAVTKKMVKTYEKLTDIIPKSAVGELSEDSSNVLELIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVSQVNQPRGDCDGVQINVPITFQVKVTASECIQEQSFVIRALGFTDTVTVRVLPQCECRCGDSSKERTLCGNKGSMECGVCRCDAGYIGKHCECQTQGRSSQELEGSCRKDNSSIICSGLGDCICGQCVCHTSDVPNKKIYGQFCECDNMNCERFDGQVCGGEKRGLCFCSTCRCQEGFEGSACQCLKSTQGCLNLQGVECSGRGRCRCNVCQCDFGYQPPLCTDCPSCQVPCARYAKCAECLKFDTGPFAKNCSAECGTTKLLPSRMSGRKCNERDSEGCWMTYFLVQRDGRDNYDLHVEETRECVKGPNIAAIVGGTVGGVVLVGIFLLVIWKVLTHLSDLREYKRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAER

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cat Kalirin (KALRN) ELISA Kit
MBS9348313 Inquire

Cat Kalirin (KALRN) ELISA Kit

Sign In for Pricing
View Details
C1ql3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6306906 1.0 µg DNA

C1ql3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Fibronectin Rabbit Polyclonal Antibody
APRab10975-01 20 µL

Fibronectin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fibronectin Rabbit Polyclonal Antibody
APRab10975-02 50 µL

Fibronectin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fibronectin Rabbit Polyclonal Antibody
APRab10975-03 100 µL

Fibronectin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fibronectin Rabbit Polyclonal Antibody
APRab10975-04 200 µL

Fibronectin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details