Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Integrin beta-2 (Itgb2)

This Recombinant Mouse Integrin beta-2 (Itgb2) spans the amino acid sequence from region 24-771.

Product Specifications

Product Name Alternative

Integrin beta-2, Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta, Complement receptor C3 subunit beta, CD_antigen= CD18

UniProt

P11835

Expression Region

24-771

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QECTKYKVSSCRDCIQSGPGCSWCQKLNFTGPGEPDSLRCDTRAQLLLKGCPADDIMDPRSIANPEFDQRGQRKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLNNVKKLGGDLLQALNEITESGRIGFGSFVDKTVLPFVNTHPEKLRNPCPNKEKACQPPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAIMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNMYKRSNEFDYPSVGQLAHKLSESNIQPIFAVTKKMVKTYEKLTEIIPKSAVGELSDDSSNVVQLIKNAYYKLSSRVFLDHSTLPDTLKVTYDSFCSNGASSIGKSRGDCDGVQINNPVTFQVKVMASECIQEQSFVIRALGFTDTVTVQVRPQCECQCRDQSREQSLCGGKGVMECGICRCESGYIGKNCECQTQGRSSQELERNCRKDNSSIVCSGLGDCICGQCVCHTSDVPNKEIFGQYCECDNVNCERYNSQVCGGSDRGSCNCGKCSCKPGYEGSACQCQRSTTGCLNARLVECSGRGHCQCNRCICDEGYQPPMCEDCPSCGSHCRDNHTSCAECLKFDKGPFEKNCSVQCAGMTLQTIPLKKKPCKERDSEGCWITYTLQQKDGRNIYNIHVEDSLECVKGPNVAAIVGGTVVGVVLIGVLLLVIWKALTHLTDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCG4 (ATP-binding Cassette Sub-family G Member 4, WHITE2) (MaxLight 490)
MBS6405052-01 0.1 mL

ABCG4 (ATP-binding Cassette Sub-family G Member 4, WHITE2) (MaxLight 490)

Sign In for Pricing
View Details
ABCG4 (ATP-binding Cassette Sub-family G Member 4, WHITE2) (MaxLight 490)
MBS6405052-02 5x 0.1 mL

ABCG4 (ATP-binding Cassette Sub-family G Member 4, WHITE2) (MaxLight 490)

Sign In for Pricing
View Details
CCNB3, phosphorylated (T257) (Ccnb3, Cycb3, G2/mitotic-specific cyclin-B3) (PE) discontinued
033394-PE 200 µL

CCNB3, phosphorylated (T257) (Ccnb3, Cycb3, G2/mitotic-specific cyclin-B3) (PE) discontinued

Sign In for Pricing
View Details
RO7185876
BA8596-1 1 mg

RO7185876

Sign In for Pricing
View Details
MAP Kinase Interacting Serine/threonine Kinase 2, CT (MAP Kinase Signal-integrating Kinase 2, MAPK Signal-integrating Kinase 2, MKNK2, MNK2, GPRK7) (AP) discontinued
M2353-75C-AP 200 µL

MAP Kinase Interacting Serine/threonine Kinase 2, CT (MAP Kinase Signal-integrating Kinase 2, MAPK Signal-integrating Kinase 2, MKNK2, MNK2, GPRK7) (AP) discontinued

Sign In for Pricing
View Details
E.coli grxB Recombinant Protein
PROTP0AC59-01 20 µg

E.coli grxB Recombinant Protein

Sign In for Pricing
View Details