Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Integrin beta-2 (Itgb2)

This Recombinant Mouse Integrin beta-2 (Itgb2) spans the amino acid sequence from region 24-771.

Product Specifications

Product Name Alternative

Integrin beta-2, Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta, Complement receptor C3 subunit beta, CD_antigen= CD18

UniProt

P11835

Expression Region

24-771

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QECTKYKVSSCRDCIQSGPGCSWCQKLNFTGPGEPDSLRCDTRAQLLLKGCPADDIMDPRSIANPEFDQRGQRKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLNNVKKLGGDLLQALNEITESGRIGFGSFVDKTVLPFVNTHPEKLRNPCPNKEKACQPPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAIMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNMYKRSNEFDYPSVGQLAHKLSESNIQPIFAVTKKMVKTYEKLTEIIPKSAVGELSDDSSNVVQLIKNAYYKLSSRVFLDHSTLPDTLKVTYDSFCSNGASSIGKSRGDCDGVQINNPVTFQVKVMASECIQEQSFVIRALGFTDTVTVQVRPQCECQCRDQSREQSLCGGKGVMECGICRCESGYIGKNCECQTQGRSSQELERNCRKDNSSIVCSGLGDCICGQCVCHTSDVPNKEIFGQYCECDNVNCERYNSQVCGGSDRGSCNCGKCSCKPGYEGSACQCQRSTTGCLNARLVECSGRGHCQCNRCICDEGYQPPMCEDCPSCGSHCRDNHTSCAECLKFDKGPFEKNCSVQCAGMTLQTIPLKKKPCKERDSEGCWITYTLQQKDGRNIYNIHVEDSLECVKGPNVAAIVGGTVVGVVLIGVLLLVIWKALTHLTDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Myosin Heavy Chain 7 Cardiac Muscle Beta ELISA Kit
IHUMYH7KT 1 Each

Human Myosin Heavy Chain 7 Cardiac Muscle Beta ELISA Kit

Sign In for Pricing
View Details
Human Anti-hepatitis A virus IgG Antibody (Anti-HAV IgG) ELISA Kit (Quantitative)
SLD0186Hu-01 48 Tests

Human Anti-hepatitis A virus IgG Antibody (Anti-HAV IgG) ELISA Kit (Quantitative)

Sign In for Pricing
View Details
Human Anti-hepatitis A virus IgG Antibody (Anti-HAV IgG) ELISA Kit (Quantitative)
SLD0186Hu-02 96 Tests

Human Anti-hepatitis A virus IgG Antibody (Anti-HAV IgG) ELISA Kit (Quantitative)

Sign In for Pricing
View Details
Mouse Transcription initiation factor TFIID subunit 7, TAF7 ELISA Kit
MBS9342986-01 48 Well

Mouse Transcription initiation factor TFIID subunit 7, TAF7 ELISA Kit

Sign In for Pricing
View Details
Mouse Transcription initiation factor TFIID subunit 7, TAF7 ELISA Kit
MBS9342986-02 96 Well

Mouse Transcription initiation factor TFIID subunit 7, TAF7 ELISA Kit

Sign In for Pricing
View Details
Mouse Transcription initiation factor TFIID subunit 7, TAF7 ELISA Kit
MBS9342986-03 5x 96 Well

Mouse Transcription initiation factor TFIID subunit 7, TAF7 ELISA Kit

Sign In for Pricing
View Details