Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANK/TNFRSF11A, Human (His)

RANK (TNFRSF11A) is a receptor activator of nuclear factor κB (NF-κB), which is involved in bone metabolism and immune system function. RANK is mainly expressed by osteoblasts/stromal cells, and is associated with the formation of giant cell tumor of bone (GCTBs) [1]. RANK combined with RANKL ligand activated the RANKL/RANK/ OPG system to regulate bone resorption [2]. RANKL/RANK is also a regulator of dendritic cell (DC) -T cell interaction, which is associated with mammary epithelial formation and central nervous system thermoregulation in lactating female [3][4]. RANK/TNFRSF11A Protein, Human (His) produced by HEK293 cells with N-terminal His-tag.

Product Specifications

Product Name Alternative

RANK/TNFRSF11A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrsf11a-protein-human-his.html

Purity

96.00

Smiles

LQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK

Molecular Formula

8792 (Gene_ID) Q9Y6Q6 (L28-K202) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Roux S, et al. RANK (receptor activator of nuclear factor kappa B) and RANK ligand are expressed in giant cell tumors of bone. Am J Clin Pathol. 2002 Feb;117 (2) :210-6.|[2]Boyce BF, et al. Biology of RANK, RANKL, and osteoprotegerin. Arthritis Res Ther. 2007;9 Suppl 1 (Suppl 1) :S1.|[3]Page G, et al. RANK and RANKL expression as markers of dendritic cell-T cell interactions in paired samples of rheumatoid synovium and lymph nodes. Arthritis Rheum. 2005 Aug;52 (8) :2307-12.|[4]Nagy V, et al. The RANKL-RANK Story. Gerontology. 2015;61 (6) :534-42.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human hsa-miR-3064-5p miRNA Antagomir
abx886844-01 10 nmol

Human hsa-miR-3064-5p miRNA Antagomir

Sign In for Pricing
View Details
Human hsa-miR-3064-5p miRNA Antagomir
abx886844-02 20 nmol

Human hsa-miR-3064-5p miRNA Antagomir

Sign In for Pricing
View Details
Rabbit Anti ARMCX1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)
MBS8422558-01 0.12 mL

Rabbit Anti ARMCX1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)

Sign In for Pricing
View Details
Rabbit Anti ARMCX1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)
MBS8422558-02 0.2 mL

Rabbit Anti ARMCX1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)

Sign In for Pricing
View Details
Rabbit Anti ARMCX1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)
MBS8422558-03 5x 0.2 mL

Rabbit Anti ARMCX1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(IHC, ELISA)

Sign In for Pricing
View Details
CMPK2 Antibody
K40017M07C08C-01 50 ug

CMPK2 Antibody

Sign In for Pricing
View Details