CD79B, Human (HEK293, His)
CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (HEK293, His) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
CD79B Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd79b-protein-human-hek-293-his.html
Purity
95.0
Smiles
ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD
Molecular Formula
974 (Gene_ID) P40259 (A29-D159) (Accession)
Molecular Weight
Approximately 25-36 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
![Rabbit Polyclonal B3GNT3 Antibody [DyLight 550]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
Recombinant Acidovorax ebreus Large-conductance mechanosensitive channel (mscL)
Recombinant Acidovorax ebreus Large-conductance mechanosensitive channel (mscL)
Recombinant Acidovorax ebreus Large-conductance mechanosensitive channel (mscL)
PARP1, phosphorylated (S372) (PARP1, ADPRT, PPOL, Poly [ADP-ribose] polymerase 1, ADP-ribosyltransferase diphtheria toxin-like 1, NAD (+) ADP-ribosyltransferase 1, Poly[ADP-ribose] synthase 1)