Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse H-2 class II histocompatibility antigen, E-U alpha chain (H2-Ea), partial

Product Specifications

Abbreviation

Recombinant Mouse H2-Ea protein, partial

Gene Name

H2-Ea

UniProt

P14439

Expression Region

26-217aa

Organism

Mus musculus (Mouse)

Target Sequence

IKEEHTIIQAEFYLLPDKRGEYMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKKRSNNTPDANVAPEVTVLSRSPVNLGEPNILVCFIDKFSPPVVNVTWLRNGQPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEFEEKTLLPETKEN

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.8 kDa

References & Citations

"The mouse as a model for the effects of MHC genes on human disease." Allcock R.J., Martin A.M., Price P. Immunol Today 21:328-332 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DHTKD1 qPCR Primer Pair
QH45101S 200 Tests

Human DHTKD1 qPCR Primer Pair

Sign In for Pricing
View Details
LOC665290 3'UTR GFP Stable Cell Line
TU162465 1.0 mL

LOC665290 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CCDC107 Protein Lysate (Human) with C-Ha Tag
15170031 100 µg

CCDC107 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Neuron Specific Nuclear Protein (NeuN)
MBS603600-01 0.1 mg

Neuron Specific Nuclear Protein (NeuN)

Sign In for Pricing
View Details
Neuron Specific Nuclear Protein (NeuN)
MBS603600-02 0.5 mg

Neuron Specific Nuclear Protein (NeuN)

Sign In for Pricing
View Details
Neuron Specific Nuclear Protein (NeuN)
MBS603600-03 5x 0.5 mg

Neuron Specific Nuclear Protein (NeuN)

Sign In for Pricing
View Details