Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACVR1, Cynomolgus (HEK293, Fc)

Activin A receptor, type I (ACVR1), also known as ALK-2, is a bone morphogenetic protein (BMP) type I receptor. ACVR1 is involved in a wide variety of biological processes, including bone, heart, cartilage, nervous, and reproductive system development and regulation[1]. ACVR1 Protein, Cynomolgus (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 101 amino acids (M1-E123) .

Product Specifications

Product Name Alternative

ACVR1 Protein, Cynomolgus (HEK293, Fc), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/acvr1-protein-cynomolgus-hek293-fc.html

Purity

96.00

Smiles

DEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLE

Molecular Formula

697935 (Gene_ID) F7A9J8 (D23-E123) (Accession)

Molecular Weight

Approximately 42-50 kDa due to the glycosylation.

References & Citations

[1]José Antonio Valer, et al. ACVR1 Function in Health and Disease. Cells. 2019 Oct 31;8 (11) :1366.|[2]Jing Pang, et al. ACVR1-Fc suppresses BMP signaling and chondro-osseous differentiation in an in vitro model of Fibrodysplasia ossificans progressive. Bone. 2016 Nov;92:29-36.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), 0.2mg/mL
BNUB2224-100 1x 100 µL

S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), 0.2mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Skin
CR560479 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
SNF2H (SMARCA5) (NM_003601) Human Over-expression Lysate
LY401193 100 µg

SNF2H (SMARCA5) (NM_003601) Human Over-expression Lysate

Sign In for Pricing
View Details
MTAP (Tumor Suppressor Marker) (MTAP/1813), 0.2mg/mL
BNUB1813-100 1x 100 µL

MTAP (Tumor Suppressor Marker) (MTAP/1813), 0.2mg/mL

Sign In for Pricing
View Details
Human SCRT1 activation kit by CRISPRa
GA113188 1 Kit

Human SCRT1 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR561966 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details