Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Red-sensitive opsin

This Recombinant Chicken Red-sensitive opsin spans the amino acid sequence from region 1-362.

Product Specifications

Product Name Alternative

Red-sensitive opsin, Iodopsin, Red cone photoreceptor pigment

UniProt

P22329

Expression Region

1-362

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAWEAAFAARRRHEEEDTTRDSVFTYTNSNNTRGPFEGPNYHIAPRWVYNLTSVWMIFV VAASVFTNGLVLVATWKFKKLRHPLNWILVNLAVADLGETVIASTISVINQISGYFILGH PMCVVEGYTVSACGITALWSLAIISWERWFVVCKPFGNIKFDGKLAVAGILFSWLWSCAW TAPPIFGWSRYWPHGLKTSCGPDVFSGSSDPGVQSYMVVLMVTCCFFPLAIIILCYLQVW LAIRAVAAQQKESESTQKAEKEVSRMVVVMIVAYCFCWGPYTFFACFAAANPGYAFHPLA AALPAYFAKSATIYNPIIYVFMNRQFRNCILQLFGKKVDDGSEVSTSRTEVSSVSNSSVS PA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLX4 (BP1, DLX7, DLX8, DLX9) discontinued
508794 100 µg

DLX4 (BP1, DLX7, DLX8, DLX9) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal ZNF544 Antibody
NBP1-89224 0.1 mL

Rabbit Polyclonal ZNF544 Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal EPX Antibody (EPX/3908R) [DyLight 594]
NBP3-08476DL594 100 µL

Rabbit Monoclonal EPX Antibody (EPX/3908R) [DyLight 594]

Sign In for Pricing
View Details
SLC5A5 CRISPR Knock Out 293T Cell Line (Human)
44240141 1x 10^6 Cells / 1.0 mL

SLC5A5 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
M3K13 Antibody
MBS852041-01 0.1 mg

M3K13 Antibody

Sign In for Pricing
View Details
M3K13 Antibody
MBS852041-02 0.1 mL (AF635)

M3K13 Antibody

Sign In for Pricing
View Details