Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Medium-wave-sensitive opsin 1 (OPN1MW)

This Recombinant Rabbit Medium-wave-sensitive opsin 1 (OPN1MW) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Medium-wave-sensitive opsin 1, Green cone photoreceptor pigment, Green-sensitive opsin, Medium wavelength-sensitive cone opsin

UniProt

O18910

Expression Region

1-364

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTQPWGPQMLAGGQPPESHEDSTQASIFTYTNSNSTRGPFEGPNFHIAPRWVYHLTSAWM ILVVIASVFTNGLVLVATMRFKKLRHPLNWILVNLAVADLAETVIASTISVVNQFYGYFV LGHPLCVVEGYTVSLCGITGLWSLAIISWERWLVVCKPFGNVRFDAKLAIAGIAFSWIWA AVWTAPPIFGWSRYWPYGLKTSCGPDVFSGTSYPGVQSYMMVLMVTCCIIPLSVIVLCYL QVWMAIRTVAKQQKESESTQKAEKEVTRMVVVMVFAYCLCWGPYTFFACFATAHPGYSFH PLVAAIPSYFAKSATIYNPIIYVFMNRQFRNCILQLFGKKVEDSSELSSASRTEASSVSS VSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Cellulolyticum rpmI Protein (aa 1-65)
VAng-Lsx9025-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Cellulolyticum rpmI Protein (aa 1-65)

Sign In for Pricing
View Details
ZFP64 Rabbit pAb, PE-Cy5.5 conjugated
orb2870900 100 µL

ZFP64 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
CXCL4L1 Overexpression Lysate (Native) - (Dry Ice)
NBP2-10840 0.1 mg

CXCL4L1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
ADA2 Human Gene Knockout Kit (CRISPR)
KN208252LP 1 Kit

ADA2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
B23 (phospho Thr199) Polyclonal Antibody
E20-60902 100 µg

B23 (phospho Thr199) Polyclonal Antibody

Sign In for Pricing
View Details
Triptolide 5mg
A11596-5 5 mg

Triptolide 5mg

Sign In for Pricing
View Details