Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Medium-wave-sensitive opsin 1 (OPN1MW)

This Recombinant Rabbit Medium-wave-sensitive opsin 1 (OPN1MW) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Medium-wave-sensitive opsin 1, Green cone photoreceptor pigment, Green-sensitive opsin, Medium wavelength-sensitive cone opsin

UniProt

O18910

Expression Region

1-364

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTQPWGPQMLAGGQPPESHEDSTQASIFTYTNSNSTRGPFEGPNFHIAPRWVYHLTSAWM ILVVIASVFTNGLVLVATMRFKKLRHPLNWILVNLAVADLAETVIASTISVVNQFYGYFV LGHPLCVVEGYTVSLCGITGLWSLAIISWERWLVVCKPFGNVRFDAKLAIAGIAFSWIWA AVWTAPPIFGWSRYWPYGLKTSCGPDVFSGTSYPGVQSYMMVLMVTCCIIPLSVIVLCYL QVWMAIRTVAKQQKESESTQKAEKEVTRMVVVMVFAYCLCWGPYTFFACFATAHPGYSFH PLVAAIPSYFAKSATIYNPIIYVFMNRQFRNCILQLFGKKVEDSSELSSASRTEASSVSS VSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Cytochrome P450 Reductase/POR Antibody Picoband® (Biotine Conjugate)
PB9736-Biotin 100 µg/Vial

Anti-Cytochrome P450 Reductase/POR Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 S1 Protein, C-Fc
E55P8636 50 µg

Recombinant SARS-CoV-2 S1 Protein, C-Fc

Sign In for Pricing
View Details
Rat Phospholipase D (PLD) ELISA Kit
YP-W34812-01 48 Tests

Rat Phospholipase D (PLD) ELISA Kit

Sign In for Pricing
View Details
Rat Phospholipase D (PLD) ELISA Kit
YP-W34812-02 96 Tests

Rat Phospholipase D (PLD) ELISA Kit

Sign In for Pricing
View Details
KCNH6 Antibody - N-terminal region
ARP35363_T100-25UL 25 µL

KCNH6 Antibody - N-terminal region

Sign In for Pricing
View Details
RNF14 Mouse Monoclonal Antibody [Clone ID: OTI1C9]
CF811050 100 µg

RNF14 Mouse Monoclonal Antibody [Clone ID: OTI1C9]

Sign In for Pricing
View Details