Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Medium-wave-sensitive opsin 1 (OPN1MW)

This Recombinant Rabbit Medium-wave-sensitive opsin 1 (OPN1MW) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Medium-wave-sensitive opsin 1, Green cone photoreceptor pigment, Green-sensitive opsin, Medium wavelength-sensitive cone opsin

UniProt

O18910

Expression Region

1-364

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTQPWGPQMLAGGQPPESHEDSTQASIFTYTNSNSTRGPFEGPNFHIAPRWVYHLTSAWM ILVVIASVFTNGLVLVATMRFKKLRHPLNWILVNLAVADLAETVIASTISVVNQFYGYFV LGHPLCVVEGYTVSLCGITGLWSLAIISWERWLVVCKPFGNVRFDAKLAIAGIAFSWIWA AVWTAPPIFGWSRYWPYGLKTSCGPDVFSGTSYPGVQSYMMVLMVTCCIIPLSVIVLCYL QVWMAIRTVAKQQKESESTQKAEKEVTRMVVVMVFAYCLCWGPYTFFACFATAHPGYSFH PLVAAIPSYFAKSATIYNPIIYVFMNRQFRNCILQLFGKKVEDSSELSSASRTEASSVSS VSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab30 3'UTR Luciferase Stable Cell Line
TU217194 1.0 mL

Rab30 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Olr517 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV635450 1.0 µg DNA

Olr517 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
P53 (phospho Ser392) Polyclonal Antibody
E20-60884 100 µg

P53 (phospho Ser392) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human EIF5B pAb
PA14449-01 50 μL

Rabbit Anti-Human EIF5B pAb

Sign In for Pricing
View Details
Rabbit Anti-Human EIF5B pAb
PA14449-02 100 μL

Rabbit Anti-Human EIF5B pAb

Sign In for Pricing
View Details
Acetyl-Hirudin (55-65) (sulfated) Ac-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr (SO3H) -Leu-Gln-OH
FA110101-01 250 µg

Acetyl-Hirudin (55-65) (sulfated) Ac-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr (SO3H) -Leu-Gln-OH

Sign In for Pricing
View Details