Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep C-C chemokine receptor type 9 (CCR9)

This Recombinant Sheep C-C chemokine receptor type 9 (CCR9) spans the amino acid sequence from region 1-367.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 9, C-C CKR-9, CC-CKR-9, CCR-9, CD_antigen= CDw199

UniProt

Q1WLP9

Expression Region

1-367

Origin

Ovis aries (Sheep)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVPTEATSLILNPSDDYGYDGTPPMEYDTNLTDYFCEKSHVRQFAGHFLPPLYWLVFIVG AVGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLTTLPFWAIAAADQWKFQTFMCKVV NSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAQMWRQKRLLYSKMVCFTIWVMAAALCLP ELLYSQVKEEHGTAICTVVYSSNESTKLKSAVLTLKVTLGFFLPFVVMACCYAIIIHTLI RAKKSSKHKALKVTITVLTVFVLSQFPHNCVLLVQTIDAYATFISSCALSIKIDICFQVT QTVAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLET TSGALSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF405S conjugate, 0.1mg/mL
BNC040333-100 1x 100 µL

CD8 (RIV11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
BNC040994-100 1x 100 µL

TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL
BNC700391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
BNC940178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF740 conjugate, 0.1mg/mL
BNC741950-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-H) (NF421), CF647 conjugate, 0.1mg/mL
BNC470421-500 1x 500 µL

Neurofilament (NF-H) (NF421), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details