Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuropeptide Y receptor type 6 (Npy6r)

This Recombinant Mouse Neuropeptide Y receptor type 6 (Npy6r) spans the amino acid sequence from region 1-371.

Product Specifications

Product Name Alternative

Neuropeptide Y receptor type 6, NPY6-R, Pancreatic polypeptide receptor 2, PP2

UniProt

Q61212

Expression Region

1-371

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVLTNQPTPNKTSGKSNNSAFFYFESCQPPFLAILLLLIAYTVILIMGIFGNLSLIIII FKKQREAQNVTNILIANLSLSDILVCVMCIPFTVIYTLMDHWVFGNTMCKLTSYVQSVSV SVSIFSLVLIAIERYQLIVNPRGWKPRVAHAYWGIILIWLISLTLSIPLFLSYHLTNEPF HNLSLPTDIYTHQVACVEIWPSKLNQLLFSTSLFMLQYFVPLGFILICYLKIVLCLRKRT RQVDRRKENKSRLNENKRVNVMLISIVVTFGACWLPLNIFNVIFDWYHEMLMSCHHDLVF VVCHLIAMVSTCINPLFYGFLNKNFQKDLMMLIHHCWCGEPQESYENIAMSTMHTDESKG SLKLAHIPTGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCR5 (N-term) Rabbit Polyclonal Antibody
AP23286PU-N 100 µg

CCR5 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (C66/1260), CF594 conjugate, 0.1mg/mL
BNC941260-500 1x 500 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/1260), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EVX1 Mouse Monoclonal Antibody [Clone ID: OTI1F4]
CF811379 100 µg

EVX1 Mouse Monoclonal Antibody [Clone ID: OTI1F4]

Sign In for Pricing
View Details
Recombinant Human UCP1 protein (His tag)
PDEH100795-01 20 µg

Recombinant Human UCP1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human UCP1 protein (His tag)
PDEH100795-02 100 µg

Recombinant Human UCP1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human UCP1 protein (His tag)
PDEH100795-03 500 µg

Recombinant Human UCP1 protein (His tag)

Sign In for Pricing
View Details