Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vasopressin V2 receptor (Avpr2)

This Recombinant Mouse Vasopressin V2 receptor (Avpr2) spans the amino acid sequence from region 1-371.

Product Specifications

Product Name Alternative

Vasopressin V2 receptor, V2R, AVPR V2, Antidiuretic hormone receptor, Renal-type arginine vasopressin receptor

UniProt

O88721

Expression Region

1-371

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MILVSTTSAVPGALSSPSSPSNSSQEELLDDRDPLLVRAELALLSTIFVAVALSNGLVLG ALIRRGRRGRWAPMHVFISHLCLADLAVALFQVLPQLAWDATDRFHGPDALCRAVKYLQM VGMYASSYMILAMTLDRHRAICRPMLAYRHGGGARWNRPVLVAWAFSLLLSLPQLFIFAQ RDVGNGSGVFDCWARFAEPWGLRAYVTWIALMVFVAPALGIAACQVLIFREIHASLVPGP SERAGRRRRGHRTGSPSEGAHVSAAMAKTVRMTLVIVIVYVLCWAPFFLVQLWAAWDPEA PLERPPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCAQRHTTHSLGPQDESCAT ASSSLMKDTPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Taq DNA Polymerase Antibody Antibody
48369-01 50 µL

Anti-Taq DNA Polymerase Antibody Antibody

Sign In for Pricing
View Details
Anti-Taq DNA Polymerase Antibody Antibody
48369-02 100 µL

Anti-Taq DNA Polymerase Antibody Antibody

Sign In for Pricing
View Details
ARMCX3 (NM_177947) Human Over-expression Lysate
LY406053 100 µg

ARMCX3 (NM_177947) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Lymphocyte Antigen 6E (LY6E) Protein
abx659047-01 10 µg

Human Lymphocyte Antigen 6E (LY6E) Protein

Sign In for Pricing
View Details
Human Lymphocyte Antigen 6E (LY6E) Protein
abx659047-02 50 µg

Human Lymphocyte Antigen 6E (LY6E) Protein

Sign In for Pricing
View Details
Human Lymphocyte Antigen 6E (LY6E) Protein
abx659047-03 100 µg

Human Lymphocyte Antigen 6E (LY6E) Protein

Sign In for Pricing
View Details