Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis High-affinity lysophosphatidic acid receptor

This Recombinant Xenopus laevis High-affinity lysophosphatidic acid receptor spans the amino acid sequence from region 1-372.

Product Specifications

Product Name Alternative

High-affinity lysophosphatidic acid receptor, PSP24

UniProt

P79945

Expression Region

1-372

Origin

Xenopus laevis (African clawed frog)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGCNNTALDNCMLPNLSIATAPLDLRFAFSTPLRMLLAIIMILMIAIAFLGNAIVCLIVY QKPAMRSAINLLLATLAFSDIMLSLFCMPFTAVTIITGSWLFGTQFCQISAMLYWFFVLE GVAILLIISVDRFLIIVQRQDKLNPHRAKIMIAASWVLSFCISLPSVVGWTLVEVPTRAP QCVLGYTEFSADRVYAVMLIVAVFFIPFSVMLYSYLCILNTVRRNAVRIHTHADSLCLSQ VSKLGLMGLQRPHQMNVDMSFKTRAFTTILILFIGFSLCWLPHSVFSLLSVFSRTFYYSS SFYSISTCTLWLTYLKSVFNPVIYCWRIKKFREACLEFMPKTFKILPNVRGRTRRRIRPS TIYVCGEHQSAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
BNC550633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL
BNC400965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF405S conjugate, 0.1mg/mL
BNC040871-500 1x 500 µL

CD71 (66IG10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
BNC471231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL
BNC740050-100 1x 100 µL

IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF740 conjugate, 0.1mg/mL
BNC741104-500 1x 500 µL

PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details