Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Manduca sexta Opsin-1 (OP1)

This Recombinant Manduca sexta Opsin-1 (OP1) spans the amino acid sequence from region 1-377.

Product Specifications

Product Name Alternative

Opsin-1, MANOP1, Rhodopsin 1, long-wavelength, Rhodopsin P520

UniProt

O02464

Expression Region

1-377

Origin

Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPGPGLAALQAWAAKSPAYGAANQTVVDKVPPDMMHMIDPHWYQFPPMNPLWHALLGFT IGVLGFVSISGNGMVIYIFMSTKSLKTPSNLLVVNLAFSDFLMMCAMSPAMVVNCYYETW VWGPFACELYACAGSLFGCASIWTMTMIAFDRYNVIVKGIAAKPMTSNGALLRILGIWVF SLAWTLLPFFGWNRYVPEGNMTACGTDYLSKSWVSRSYILIYSVFVYFLPLLLIIYSYFF IVQAVAAHEKAMREQAKKMNVASLRSSEAANTSAECKLAKVALMTISLWFMAWTPYLVIN YTGVFESAPISPLATIWGSLFAKANAVYNPIVYGISHPKYQAALYAKFPSLQCQSAPEDA GSVASGTTAVSEEKPAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Myometrium
CS700534 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
Recombinant Laminin alpha 3 Antibody
RC-14991-01 50 μL

Recombinant Laminin alpha 3 Antibody

Sign In for Pricing
View Details
Recombinant Laminin alpha 3 Antibody
RC-14991-02 100 µL

Recombinant Laminin alpha 3 Antibody

Sign In for Pricing
View Details
Recombinant Laminin alpha 3 Antibody
RC-14991-03 1 mL

Recombinant Laminin alpha 3 Antibody

Sign In for Pricing
View Details
FITC Conjugated Morniga G Lectin (black mulberry) -MNA-G-
F-9005-1 1 mg

FITC Conjugated Morniga G Lectin (black mulberry) -MNA-G-

Sign In for Pricing
View Details
QuantiChrom™ Total Carbohydrate Assay Kit
TCRB-100 100 Tests

QuantiChrom™ Total Carbohydrate Assay Kit

Sign In for Pricing
View Details