Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Opsin-5 (Opn5)

This Recombinant Mouse Opsin-5 (Opn5) spans the amino acid sequence from region 1-377.

Product Specifications

Product Name Alternative

Opsin-5, G-protein coupled receptor 136, G-protein coupled receptor PGR12, Neuropsin

UniProt

Q6VZZ7

Expression Region

1-377

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALNHTALPQDERLPHYLRDEDPFASKLSWEADLVAGFYLTIIGILSTFGNGYVLYMSSR RKKKLRPAEIMTINLAVCDLGISVVGKPFTIISCFCHRWVFGWFGCRWYGWAGFFFGCGS LITMTAVSLDRYLKICYLSYGVWLKRKHAYICLAVIWAYASFWTTMPLVGLGDYAPEPFG TSCTLDWWLAQASGGGQVFILSILFFCLLLPTAVIVFSYAKIIAKVKSSSKEVAHFDSRI HSSHVLEVKLTKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAM YNPIIYQVIDYRFACCQAGGLRGTKKKSLEDFRLHTVTAVRKSSAVLEIHPESSSRFTSA HVMDGESHSNDGDCGKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCR4 (Fusin, LESTR, HUMSTR, C-X-C Chemokine Receptor 4, CD184) (BSA & Azide Free) (MaxLight 650)
MBS6471082-01 0.1 mL

CXCR4 (Fusin, LESTR, HUMSTR, C-X-C Chemokine Receptor 4, CD184) (BSA & Azide Free) (MaxLight 650)

Sign In for Pricing
View Details
CXCR4 (Fusin, LESTR, HUMSTR, C-X-C Chemokine Receptor 4, CD184) (BSA & Azide Free) (MaxLight 650)
MBS6471082-02 5x 0.1 mL

CXCR4 (Fusin, LESTR, HUMSTR, C-X-C Chemokine Receptor 4, CD184) (BSA & Azide Free) (MaxLight 650)

Sign In for Pricing
View Details
CDC42 Antibody
A16734-100UG 100 µg

CDC42 Antibody

Sign In for Pricing
View Details
KIR3.4 Polyclonal Antibody
JOT-AP04821-01 20 µL

KIR3.4 Polyclonal Antibody

Sign In for Pricing
View Details
KIR3.4 Polyclonal Antibody
JOT-AP04821-02 50 μL

KIR3.4 Polyclonal Antibody

Sign In for Pricing
View Details
KIR3.4 Polyclonal Antibody
JOT-AP04821-03 100 µL

KIR3.4 Polyclonal Antibody

Sign In for Pricing
View Details