Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Opsin-5 (Opn5)

This Recombinant Mouse Opsin-5 (Opn5) spans the amino acid sequence from region 1-377.

Product Specifications

Product Name Alternative

Opsin-5, G-protein coupled receptor 136, G-protein coupled receptor PGR12, Neuropsin

UniProt

Q6VZZ7

Expression Region

1-377

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALNHTALPQDERLPHYLRDEDPFASKLSWEADLVAGFYLTIIGILSTFGNGYVLYMSSR RKKKLRPAEIMTINLAVCDLGISVVGKPFTIISCFCHRWVFGWFGCRWYGWAGFFFGCGS LITMTAVSLDRYLKICYLSYGVWLKRKHAYICLAVIWAYASFWTTMPLVGLGDYAPEPFG TSCTLDWWLAQASGGGQVFILSILFFCLLLPTAVIVFSYAKIIAKVKSSSKEVAHFDSRI HSSHVLEVKLTKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAM YNPIIYQVIDYRFACCQAGGLRGTKKKSLEDFRLHTVTAVRKSSAVLEIHPESSSRFTSA HVMDGESHSNDGDCGKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli O8 Cobalamin synthase (cobS)
MBS7012084-01 0.02 mg

Recombinant Escherichia coli O8 Cobalamin synthase (cobS)

Sign In for Pricing
View Details
Recombinant Escherichia coli O8 Cobalamin synthase (cobS)
MBS7012084-02 0.1 mg

Recombinant Escherichia coli O8 Cobalamin synthase (cobS)

Sign In for Pricing
View Details
Recombinant Escherichia coli O8 Cobalamin synthase (cobS)
MBS7012084-03 5x 0.1 mg

Recombinant Escherichia coli O8 Cobalamin synthase (cobS)

Sign In for Pricing
View Details
GPSN2 Protein Vector (Human) (pPM-C-HA)
22616021 500 ng

GPSN2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Monoclonal DLC8 Antibody (N-term), Clone: EP1660Y
APR07589G 0.1ml

Monoclonal DLC8 Antibody (N-term), Clone: EP1660Y

Sign In for Pricing
View Details
Nrip3 3'UTR GFP Stable Cell Line
TU164326 1.0 mL

Nrip3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details