Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable G-protein coupled receptor 34 (GPR34)

This Recombinant Human Probable G-protein coupled receptor 34 (GPR34) spans the amino acid sequence from region 1-381.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 34

UniProt

Q9UPC5

Expression Region

1-381

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTS YSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKW TLGVILCKVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWM LALGGFLTMIILTLKKGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIK IGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCY WKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFK PGYSLHDTSVAVKIQSSSKST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), 0.2mg/mL
BNUB0965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), 0.2mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Ovary
CR560065 5 µg

Tissue Total RNA, Ovary

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD19 Antibody[CB19]
E-AB-F1004P-01 20 Tests

PE/Elab Fluor® 594 Anti-Human CD19 Antibody[CB19]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD19 Antibody[CB19]
E-AB-F1004P-02 100 Tests

PE/Elab Fluor® 594 Anti-Human CD19 Antibody[CB19]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD19 Antibody[CB19]
E-AB-F1004P-03 2x 100 Tests

PE/Elab Fluor® 594 Anti-Human CD19 Antibody[CB19]

Sign In for Pricing
View Details
Ethyl Acid Tartrate
TRC-E679620-25MG 25 mg

Ethyl Acid Tartrate

Sign In for Pricing
View Details