Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable G-protein coupled receptor 34 (GPR34)

This Recombinant Human Probable G-protein coupled receptor 34 (GPR34) spans the amino acid sequence from region 1-381.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 34

UniProt

Q9UPC5

Expression Region

1-381

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTS YSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKW TLGVILCKVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWM LALGGFLTMIILTLKKGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIK IGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCY WKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFK PGYSLHDTSVAVKIQSSSKST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PFN3 Human Gene Knockout Kit (CRISPR)
KN424947 1 Kit

PFN3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LBP Human Gene Knockout Kit (CRISPR)
KN421961 1 Kit

LBP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GPC1 Rabbit Polyclonal Antibody
R1512-15 100 µL

GPC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TAOK2 Rabbit Polyclonal Antibody
TA382299 100 µL

TAOK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ENTPD8 activation kit by CRISPRa
GA117845 1 Kit

Human ENTPD8 activation kit by CRISPRa

Sign In for Pricing
View Details
ViPrimePLUS AtTaq qPCR Master Mix, 150rxns
QLMM01 150 Reactions

ViPrimePLUS AtTaq qPCR Master Mix, 150rxns

Sign In for Pricing
View Details