Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Neuropeptide Y receptor type 1 (NPY1R)

This Recombinant Pig Neuropeptide Y receptor type 1 (NPY1R) spans the amino acid sequence from region 1-383.

Product Specifications

Product Name Alternative

Neuropeptide Y receptor type 1, NPY1-R

UniProt

O02835

Expression Region

1-383

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSTLSSQVENHSIYYNFSEKNSQFLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLA LIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEVMCKLNPFVQ CVSITVSIFSLVLIAVERHQLIINPRGWRPSNRHAYVGIAVIWVLAVASSLPFLIYQVLT DEPFQNVTLDAFKDKYVCFDKFLSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKR RNNMMDKMRDNKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNL LFLLCHLTAMISTCINPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYEVIAMSTMHTDVS KTSLKQASPVALKKIHSDDNEKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF770 conjugate, 0.1mg/mL
BNC701052-500 1x 500 µL

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF594 conjugate, 0.1mg/mL
BNC941045-100 1x 100 µL

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL
BNC041081-500 1x 500 µL

CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
BNC940026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Heparan Sulphate Proteoglycan (A7L6), CF647 conjugate, 0.1mg/mL
BNC470315-100 1x 100 µL

Heparan Sulphate Proteoglycan (A7L6), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details