Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Takifugu rubripes Sphingosine 1-phosphate receptor 3 (s1pr3)

This Recombinant Takifugu rubripes Sphingosine 1-phosphate receptor 3 (s1pr3) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

Sphingosine 1-phosphate receptor 3, S1P receptor 3, S1P3, Sphingosine 1-phosphate receptor Edg-3, S1P receptor Edg-3

UniProt

Q9PUQ8

Expression Region

1-384

Origin

Takifugu rubripes (Japanese pufferfish) (Fugu rubripes)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMINPLIYLHYNYTGKLDHRPTVGTSPGTRDPKTIAFLVVCSFIILENLTVLLAIWKNHR FHNRMYFFIGNLALCDLLASVAYLVNLLLSGEKTLQLSPVLWFVREGSMFVTLGASIFSL LAIAIERHLTMIKMRPYDASKNYRVFLLIGTCWLVAVLLGALPILGWNCLGNLPDCSTIL PLYTKKYVAFCIIVFIVLLLAMSVLYARIYILVKSSSQKVSKHRNSEHAMSLLRTVIIVV GVFIACWMPIFVLLLLDVACERPCPILYKADWFIAVAVLNSAMNPIIYTLASREMRRAFL GLVCGVCYRGNGSGNDSGNKQFQEPSRSRSKSWSSQTHPNQSQQSSRPAELDREQETGHG EISVVAGGAAQASQREGEGGNGGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL
BNC470204-500 1x 500 µL

Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF594 conjugate, 0.1mg/mL
BNC940008-100 1x 100 µL

MAGE A1 (MA454), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-500 1x 500 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL
BNC680669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2618), CF594 conjugate, 0.1mg/mL
BNC942618-100 1x 100 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2618), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (AE-1), CF405S conjugate, 0.1mg/mL
BNC040252-500 1x 500 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details