Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Neuropeptide Y receptor type 2 (NPY2R)

This Recombinant Chicken Neuropeptide Y receptor type 2 (NPY2R) spans the amino acid sequence from region 1-385.

Product Specifications

Product Name Alternative

Neuropeptide Y receptor type 2, NPY2-R, NPY-Y2 receptor, Y2 receptor

UniProt

Q9DDN6

Expression Region

1-385

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGPLEAIGEENQTDEMKMELFTKLYLPRYTTPVSELALDPKPELKDSTTLVEVQIILIFA YCSIILLGVIGNSLVIHVIIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLVYTLLGEW KLGPVLCHLVPYAQALAVHVSTVTLTVIALDRHRCIVYHLESKISKRISFLIIGVAWAVS ALLASPLAIFREYSLIEIIPDFKIVVCSEKWPGEGQLNYGTIYSVSMLLIQYVLPLAIIS YAYTRIWTKLKNHVSPGAGNDHYHHRRQKTTKMLVCVVVVFAVSWLPFHAFQLVSDIDSQ VLDLKEYKLIYTVFHVIAMCSTFANPLLYGWMNNNYRTAFLTAFQCEQRLDSIHPEVSAA FKARKKLEAKKSQFPGDSFTQPTNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IgG3 Isotype Control for In Vivo - Low Endotoxin (MG3-35) [ICH2249]
ICH2249-25mg 25 mg

Mouse IgG3 Isotype Control for In Vivo - Low Endotoxin (MG3-35) [ICH2249]

Sign In for Pricing
View Details
PP5 Antibody: PerCP
SMC-244D-PCP 100 µg

PP5 Antibody: PerCP

Sign In for Pricing
View Details
LRRC50 (DNAAF1) Human qPCR Primer Pair (NM_178452)
HP218809 200 Reactions

LRRC50 (DNAAF1) Human qPCR Primer Pair (NM_178452)

Sign In for Pricing
View Details
TRIP15 (COPS2) (NM_004236) Human Over-expression Lysate
LC401357 20 µg

TRIP15 (COPS2) (NM_004236) Human Over-expression Lysate

Sign In for Pricing
View Details
GlycoLinerTM Biotin Cell Surface Glycoprotein Labeling Kit, 100 Labelings
#30143-T 1 Kit

GlycoLinerTM Biotin Cell Surface Glycoprotein Labeling Kit, 100 Labelings

Sign In for Pricing
View Details
Anti-Crotonyl Lysine Antibody
KC-2330-01 50 μL

Anti-Crotonyl Lysine Antibody

Sign In for Pricing
View Details