Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Neuropeptide Y receptor type 2 (NPY2R)

This Recombinant Chicken Neuropeptide Y receptor type 2 (NPY2R) spans the amino acid sequence from region 1-385.

Product Specifications

Product Name Alternative

Neuropeptide Y receptor type 2, NPY2-R, NPY-Y2 receptor, Y2 receptor

UniProt

Q9DDN6

Expression Region

1-385

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGPLEAIGEENQTDEMKMELFTKLYLPRYTTPVSELALDPKPELKDSTTLVEVQIILIFA YCSIILLGVIGNSLVIHVIIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLVYTLLGEW KLGPVLCHLVPYAQALAVHVSTVTLTVIALDRHRCIVYHLESKISKRISFLIIGVAWAVS ALLASPLAIFREYSLIEIIPDFKIVVCSEKWPGEGQLNYGTIYSVSMLLIQYVLPLAIIS YAYTRIWTKLKNHVSPGAGNDHYHHRRQKTTKMLVCVVVVFAVSWLPFHAFQLVSDIDSQ VLDLKEYKLIYTVFHVIAMCSTFANPLLYGWMNNNYRTAFLTAFQCEQRLDSIHPEVSAA FKARKKLEAKKSQFPGDSFTQPTNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Glutathione S Transferase Theta 1 (GSTt1) ELISA Kit
RD-GSTt1-Hu-01 96 Tests

Human Glutathione S Transferase Theta 1 (GSTt1) ELISA Kit

Sign In for Pricing
View Details
Human Glutathione S Transferase Theta 1 (GSTt1) ELISA Kit
RD-GSTt1-Hu-02 48 Tests

Human Glutathione S Transferase Theta 1 (GSTt1) ELISA Kit

Sign In for Pricing
View Details
4-HNE (4-Hydroxynonenal) ELISA Kit
E-EL-0128-01 24 Tests

4-HNE (4-Hydroxynonenal) ELISA Kit

Sign In for Pricing
View Details
4-HNE (4-Hydroxynonenal) ELISA Kit
E-EL-0128-02 48 Tests

4-HNE (4-Hydroxynonenal) ELISA Kit

Sign In for Pricing
View Details
4-HNE (4-Hydroxynonenal) ELISA Kit
E-EL-0128-03 96 Tests

4-HNE (4-Hydroxynonenal) ELISA Kit

Sign In for Pricing
View Details
GAS2 Human qPCR Primer Pair (NM_177553)
HP228497 200 Reactions

GAS2 Human qPCR Primer Pair (NM_177553)

Sign In for Pricing
View Details