Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 5-hydroxytryptamine receptor 1B (Htr1b)

This Recombinant Mouse 5-hydroxytryptamine receptor 1B (Htr1b) spans the amino acid sequence from region 1-386.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1B, 5-HT-1B, 5-HT1B, Serotonin receptor 1B

UniProt

P28334

Expression Region

1-386

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEQGIQCAPPPPAASQTGVPLTNLSHNCSADGYIYQDSIALPWKVLLVALLALITLATT LSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDF WLSSDITCCTASIMHLCVIALDRYWAITDAVEYSAKRTPKRAAIMIVLVWVFSISISLPP FFWRQAKAEEEMLDCFVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQTP NKTGKRLTRAQLITDSPGSTSSVTSINSRAPDVPSESGSPVYVNQVKVRVSDALLEKKKL MAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLI NPIIYTMSNEDFKQAFHKLIRFKCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tygon Tube F-4040-A, 9.50 x 3.20 mm
1214577 15 PK

Tygon Tube F-4040-A, 9.50 x 3.20 mm

Sign In for Pricing
View Details
Lentiviral human RANBP3L shRNA (UAS) - Lentiviral human RANBP3L shRNA (UAS, iRFP) plasmid
GTR15351463 1 Vial

Lentiviral human RANBP3L shRNA (UAS) - Lentiviral human RANBP3L shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
IU1, USP-14 inhibitor
TBI1197-50MG 50 mg

IU1, USP-14 inhibitor

Sign In for Pricing
View Details
Recombinant Human PPARA Protein, N-His
orb3061240-01 50 µg

Recombinant Human PPARA Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PPARA Protein, N-His
orb3061240-02 100 µg

Recombinant Human PPARA Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PPARA Protein, N-His
orb3061240-03 1 mg

Recombinant Human PPARA Protein, N-His

Sign In for Pricing
View Details